KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02525Help
Entry
VVMO6_02525       CDS       T01415                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vvm  Vibrio vulnificus MO6-24/O
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2718498..2719283)
Genome map
AA seq 261 aa AA seqDB search
MSVLRRLTLLTLPLFVTACGAEESQAVETAQPAAQVAASTHFDSEALKARFSKLGLNIMD
IQPSDVAGLVEIQTSGGVLFASNDGSHFIAGTLYSIDENGQYKDVIAERQAPLNAKKIAE
FADSAIEYKAKDEKYVVTVFTDITCGYCVRLHSQMQGYNDLGITVRYMAYPRQGGTGPVA
EQMAGIWCAANPQEAMHDAKVNRKFAPAKNDLQQCKQTVAQHYQLGQQLGITGTPAIFLP
NGELVAGYLPPEKLLERLQQP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgattaactcttttaactcttcctctctttgtgacggcctgcggt
gctgaagaaagccaagcggtcgaaacagctcagccagcggcacaagtggcggcgagcacg
cattttgatagcgaggctctcaaagctcgtttttccaagctgggcctgaacatcatggat
attcaaccttcggatgtggcgggtttagtcgaaattcaaaccagtggcggggtgttattt
gcgtctaatgacggtagccactttatcgcaggaaccttgtattccattgacgaaaatggt
caatacaaggacgtaatcgcagaacgccaagcgccgctcaacgccaagaaaattgccgaa
tttgctgacagcgcgatcgagtacaaagccaaagatgaaaaatacgtggtgacggtgttt
accgacattacttgcggttactgcgttcgtctacacagccagatgcagggctacaatgac
ttaggtatcaccgtgcgttacatggcatacccacgccaaggtggcacgggccctgtggca
gaacaaatggcgggcatctggtgtgccgctaatccgcaagaagcgatgcatgatgctaaa
gtgaaccgcaaatttgccccagcgaaaaatgatttacagcagtgcaagcagaccgtggct
caacattaccaacttggtcagcaactcggtattacaggcacgcctgcgattttcttgcca
aatggtgagctggttgctggttacttgccaccagaaaaactgctagaacgtttacagcaa
ccataa

DBGET integrated database retrieval system