KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02540Help
Entry
VVMO6_02540       CDS       T01415                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vvm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vvm00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:vvm00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2731403..2732683)
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAELPKFDDIDALLAQDFISRSTAILSAL
IGDELAEDKVNSMVDAAFQFPAPIKQVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
DGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGKWDPKPTVATTSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYSLGYLCEPHGAIAYRVLD
QQLQEGETGLFLCTAHPAKFKEVVDDILGSDIDLPAPLAKHAVMELLSEELDADFTALKE
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaacataaaagaaaatgacgaacaagtttcctttggccaagccgtgcgc
caagggttaggccgtaatcaggggctatttttcccagcagaattaccgaaatttgacgat
atcgatgcattgcttgcgcaagattttatctcgcgcagcactgcgattctttctgcgtta
attggtgatgagctagcagaagacaaagttaactcaatggtggatgcggcattccagttc
ccagcaccgattaaacaagtgaaagagggtgtctacgctcttgaactgttccatggaccg
acacttgctttcaaagacttcggtggccgctttatggctcagtcgttggctgcggtttct
gatggtggaaaaatcactattctaacggcgacatcgggtgatacaggagccgcggttgca
cacgctttttacggaatggaagacatcaatgtggtcattctttatccgaaaggcaaaatc
agcccattgcaagaaaagctgttctgcacattaggcaaaaacattcacacggtagcgatc
aatggtgactttgacgcgtgtcaggcgctggtgaaacaagcgtttgatgatgcagaactg
cgtgaagagattggtctaaactctgcaaactcaatcaacattagccgtttgatggcgcaa
atctgctactactttgaagcagcggcgcaaatgagtaagcaagagcgcgagaatctggtg
gtgtcggtaccaagcggcaactttggtaaccttactgcgggtttgcttgctaaagctctg
ggtttaccgattaagcgctttatcgctgcaacgaatgccaatgataccgtgcctcgttac
ctagaaaccggtaaatgggatccaaaaccgactgtcgcgacgacctcaaatgccatggac
gtgagtcagcctaataactggccacgaattgaagagttgtgccgtgtgaaagagtggggt
ttggaaactttgggcaaaggtgctgtgtctgatgagcaaagtgcgcaatcggtgaaagat
ctctattcacttggttacctgtgtgaaccacatggtgcgattgcctatcgtgtgctggat
cagcagctacaagaaggtgaaactggcttgttcctctgtaccgcacatccggcgaagttt
aaggaagtggtcgatgacattcttggcagtgacatcgatttgccagcacctctagcaaaa
catgccgtgatggagctgctctctgaagagttggatgcggattttacggctctgaaagaa
gtattgcgtcgcgtgcaataa

DBGET integrated database retrieval system