KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02844Help
Entry
VVMO6_02844       CDS       T01415                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VVMO6_02844
Enzymes [BR:vvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VVMO6_02844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3045474..3046097
Genome map
AA seq 207 aa AA seqDB search
MGKGTLYIVSAPSGAGKSSLISAMLEKNPTYAMKVSVSHTTRGMRPGEQDGVHYHFVEKE
HFEDLITKGEFLEYAEVFGNYYGTSRVWIENTLDKGIDVFLDIDWQGARQIREQMPHAKS
IFILPPSNGELERRLNTRGQDSEAVIAKRMAEAKSEISHYNEYDYVIINDDFDTALMDFK
AIIRAERLKQDKQAAKYSGMLDALLAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtactctttacatcgtctctgctccaagcggtgcaggcaaatccagctta
atctccgcgatgctggagaaaaacccgacttacgcaatgaaagtgtcggtctctcacacc
acacgtggcatgcgcccaggtgaacaagatggcgtgcactaccactttgtcgagaaagag
cattttgaagatctgattaccaaaggcgagtttctggaatacgcagaagtgtttggtaac
tactacggcacctcacgtgtttggattgaaaacaccctagataaaggcattgatgttttt
ctcgatatcgattggcaaggcgctcgtcaaattcgtgagcaaatgccacacgctaagagc
atctttatcttaccaccatccaatggtgaacttgagcgtcgtcttaatacgcgtggtcaa
gacagtgaagcggtgatcgccaagcgtatggcggaagcgaaatccgaaatctcgcactac
aacgaatacgattacgtgatcatcaacgatgatttcgatactgctttgatggactttaaa
gccattatccgagcagaaagattgaagcaagacaaacaagctgctaaatatagcggtatg
cttgacgcgcttttagcggaataa

DBGET integrated database retrieval system