KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02953Help
Entry
VVMO6_02953       CDS       T01415                                 

Definition
(GenBank) enoyl-CoA hydratase / delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00071  Fatty acid degradation
vvm00280  Valine, leucine and isoleucine degradation
vvm00281  Geraniol degradation
vvm00310  Lysine degradation
vvm00362  Benzoate degradation
vvm00380  Tryptophan metabolism
vvm00410  beta-Alanine metabolism
vvm00640  Propanoate metabolism
vvm00650  Butanoate metabolism
vvm00903  Limonene and pinene degradation
vvm00930  Caprolactam degradation
vvm01040  Biosynthesis of unsaturated fatty acids
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
vvm01200  Carbon metabolism
vvm01212  Fatty acid metabolism
Module
vvm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VVMO6_02953
   00650 Butanoate metabolism
    VVMO6_02953
  Lipid metabolism
   00071 Fatty acid degradation
    VVMO6_02953
   01040 Biosynthesis of unsaturated fatty acids
    VVMO6_02953
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VVMO6_02953
   00310 Lysine degradation
    VVMO6_02953
   00380 Tryptophan metabolism
    VVMO6_02953
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VVMO6_02953
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VVMO6_02953
   00281 Geraniol degradation
    VVMO6_02953
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VVMO6_02953
   00930 Caprolactam degradation
    VVMO6_02953
Enzymes [BR:vvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VVMO6_02953
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VVMO6_02953
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VVMO6_02953
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VVMO6_02953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV87975
Position
I:3164779..3166950
Genome map
AA seq 723 aa AA seqDB search
MIYQAETLQVKEVQDGVAEILFCAPNSVNKLDLATLASLDKALDALTAHSGLKGVMLTSD
KEAFIVGADITEFLGLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCEC
VLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRAEEALK
IGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSALTLSKLEAMMSFTMAKGLV
AQVAGPHYPAPMTAVVTIEEGARFARNQALDIERKHFVKLAKSEEAKALVGLFLNDQYIK
GIAKKAAKSANKETQRAAVLGAGIMGGGIAYQSALKGVPVIMKDIAQASLDLGMTEASKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVEAVVENPKVKAAVLSEVEEQVS
EETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFEANKYGQKNGSGFYTYTMDKKGK
PKKAFSDEIVPILAPVCAAQQAFDDQTIIQRMMIPMINEVVLCLQEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVELGAMYQVPQMLIDMAEKGQTFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgaaaccctacaggtaaaggaagtacaagatggagtggcagaaatc
cttttctgcgcgccaaattccgtcaataagctcgatctagcaactcttgcttcactcgac
aaagcgcttgatgcgctcaccgctcactccggtctgaaaggcgtaatgcttacatcagac
aaagaagcctttattgtcggagcagatatcactgagtttttaggactgtttgccaagcca
gaagaagagctcgaccaatggcttcaatttgccaatagcatcttcaataaattggaagat
ttgcccgttccgactgtcgcggttgtcaaagggcataccttaggcggtggatgtgagtgt
gtacttgctaccgatttacgcattggtgataaaaccaccagcattggtcttcctgaaacc
aaactcggcattatgcctggctttggcggttgtgtgcgtttgccgcgcgtgatcggcgca
gacagcgccatggaaatcatcactcaaggcaaagcttgccgtgcagaggaagctctaaaa
attggtttgcttgatgctgtcgtcgattccgatcgcctctacgcatccgccctgcaaaca
ctcaccgatgccatcaatgaaaaaattgactggaaagcacgtcgccagcaaaaaacctca
gcgttaacgctaagcaaactcgaagcgatgatgagtttcaccatggccaaaggcttggtg
gctcaagtagcagggccccactaccctgcaccaatgaccgccgttgtcacgattgaagaa
ggtgcccgttttgcacgcaatcaagcgttagacatcgaaagaaaacatttcgttaaactg
gcgaagtcagaagaagccaaggccttggtgggtcttttcctcaatgaccaatacatcaaa
ggcatcgcgaagaaagcagcaaaatccgccaataaagagacccaacgtgcagcagtgctg
ggcgcaggtattatggggggcggcatagcctaccaatctgctctcaaaggtgtgcccgtg
atcatgaaagacatcgcccaagcatcactggatctgggcatgacggaagcgtcaaagcta
ctcaataaacagcttgaacgtggcaagattgatggctttaaaatggccggcattctcgct
tctattacaccaagccttcactacgcgggcatcgataacgccgatatcattgttgaagcc
gtggtcgaaaacccgaaagtgaaagcagccgtgttaagtgaagtggaagagcaagtgagc
gaagagaccgttctcacctcgaacacctcgaccattccaattaacttgctggccaaatca
ctcaaacgaccagagaacttctgtggtatgcacttcttcaacccagtgcatcgcatgcct
ttagtcgaaatcattcgtggcgaacacacctccgatgaaaccatcaaccgtgtcgttgct
tacgcagccaaaatgggcaaatccccaatagtggtcaatgactgcccagggttctttgtg
aaccgcgtgctgttcccatactttggcggttttagcatgttgctgcgcgatggtgccgac
ttcactcaaatcgataaagtgatggaacgtaaattcggttggccaatgggccctgcttac
ttattggatgtggtcggtattgataccgcacaccacgctcaagccgtcatggcgcaaggg
ttccctgagcgcatgggtaaacaaggtcgcgatgcgattgatgccttgtttgaagccaac
aagtatggccagaaaaacggcagcggtttctacacgtacaccatggacaagaaaggcaaa
ccgaagaaagcattcagtgatgagatcgtaccgattcttgctcctgtttgtgccgctcaa
caagcctttgatgatcaaaccattatccaacgcatgatgattccgatgatcaacgaagtg
gtgctttgcttgcaagaaggcattatcgcttcagcgcaagaagcggatatggcgctggtg
tatggccttggtttccctcctttccgtggtggtgtattccgctacttagatagtgttggt
attgcaaactttgtcgcaatggcacagcagcatgttgaacttggcgctatgtatcaggtt
ccacaaatgcttattgatatggctgaaaaagggcaaaccttttacggcgcgcaacagcaa
ggttctatctaa

DBGET integrated database retrieval system