KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03058Help
Entry
VVMO6_03058       CDS       T01415                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VVMO6_03058
Enzymes [BR:vvm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VVMO6_03058
Exosome [BR:vvm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VVMO6_03058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:88775..91003
Genome map
AA seq 742 aa AA seqDB search
MRIVFTTLAVWRGKKGLKKLVKSKVNQMFEKLSQAACSEPFAFLGPFIDPTQGALRVWMP
GATGVALVLEGQPRIALEREKESAFILKADLNLHLTHYQLAIDWNGVEQLIDDPYQYHGI
YAEYDDLHTPKTMYQHMGSQFMTLERDGKSISGIRFLVYAPHATAVSLVGCFNDWDGRRH
PMQRLDYGIWGLFIPGLTEGVSYKFEMKGPKGEGLPHKADPWGFYAEQYPSFASVTYDHA
RYQWQDAQWQTRPVTEKRKEALSFYELHAGSWKRNEQGEFLNYRELAAELVPYLVDMGYT
HVELMPVSEHPFYGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGIGVVLDWVPAHFP
SDDHGLANFDGTPLFHDPDPRRGWHQDWNSFIYDLGREQVRRFLVSNALYWFEQFHIDGI
RVDAVASMLYLDYSRSHGQWIPNMDGGNENYDAIATLKWMNEEVYKYFPNAMTIAEESTA
FPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIKEEPVHRKYHHNTLTFPLVYAHSENYVLS
LSHDEVVYGKGSIHNKMPGDEWQQTANLRAYFGYMYGQPGKKLNFMGAEIGQTAEWNHDD
QLQWFLLDFPRHQGVQALTRDLNHLYRNEAALHDQDCIPAGFEWRLQDAAEQSIIAHERI
SEAGERILVVSNFTPVPRDEFRLGVPNKGRYQLLLNTDDSKYAGSGYEVVVDAKSEAVVS
EDLAQSIVLRLPPLSTLFYKLV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgtgttcacaacgttggctgtttggcgagggaaaaaaggtttgaaaaaatta
gtaaaaagtaaagtgaatcagatgtttgagaaattgtctcaagccgcttgttcagagccg
tttgcatttttaggtccatttattgacccaacacaaggggcactgcgcgtctggatgccg
ggtgcaacgggggtggcattggtattagaaggccaaccacgtatcgcgcttgagcgagaa
aaagagagtgccttcattctcaaagccgatctcaatctgcatcttacccattatcaattg
gcgatcgattggaatggcgtcgagcaacttatcgatgacccataccaataccacggtatc
tacgcggagtatgacgatctccacacgccgaaaaccatgtatcaacacatgggctcacag
tttatgacgcttgagcgcgacggcaaatcaatctcaggtatccgtttcttggtgtatgcg
ccgcatgcgaccgcagtgagtctcgtaggctgtttcaatgattgggatggccgacgtcat
ccaatgcagcgccttgattacggcatttggggtttattcattccggggttaaccgaaggg
gtgagctacaaattcgaaatgaaagggccgaagggggaaggcttaccacacaaagccgac
ccttggggtttctacgccgagcaatacccatcttttgcttccgtcacgtacgatcacgct
cgttaccagtggcaagacgcccagtggcaaactcgcccagtgaccgagaaacgcaaagaa
gcgctctctttctacgagttgcatgctggttcttggaagcgcaacgagcaaggtgagttc
ctgaattatcgcgaactggccgccgagttggtgccctatttggtggatatgggctacacc
catgttgaactgatgcctgtctctgagcacccgttctacggctcttggggttaccagcct
gtgggtctctttgcgccaactagccgctatggttcacccgatgatttcaaattcttcgtc
gatgcgtgtcaccaagcgggcattggtgtggtattggattgggtgcctgcgcacttccca
tcggacgatcacggcttggccaattttgatggtacaccattgttccacgacccagaccca
cgccgtggttggcaccaagactggaactcgtttatctacgatcttggccgcgagcaagta
cgccgtttcttggtttctaacgctctgtattggtttgagcagttccatatcgatggtatt
cgggtggatgcggtggcatcgatgctgtatctcgattattcacgcagccatggccagtgg
atcccgaacatggatggcggcaacgaaaactacgatgcgattgccaccctaaaatggatg
aatgaggaagtgtacaaatacttcccgaatgcgatgacgattgcggaagagtcgactgct
ttcccgggcgtgtccgcaccgacctttatgggcggtttgggctttggctttaagtggaat
atggggtggatgcacgatagtctttcttacatcaaagaagagcctgttcatcgcaaatac
caccacaataccctcacgttcccactcgtttacgctcacagtgagaactacgtcttgtca
ctttctcacgatgaagtggtatacggcaaaggttctattcacaacaaaatgccaggtgat
gagtggcagcaaaccgccaatttacgtgcgtattttggttacatgtatggtcaaccgggc
aaaaaactcaactttatgggcgcggaaatcggccaaacggcagagtggaatcacgatgac
caactgcaatggttcttgctcgatttcccacgtcaccaaggcgtgcaagccttgacgcgt
gatctcaaccacttgtatcgaaatgaagcggcgctgcacgatcaagattgcatcccagcc
ggttttgagtggcgtttacaagatgctgccgagcagagcattattgctcatgagcgtatc
agtgaagcaggcgagcgcattctggtagtgagtaactttaccccagtgccacgtgatgaa
ttccgcttaggcgtgccaaacaaaggccgctaccaattgctgctcaacaccgacgacagc
aaatacgcaggcagtggctacgaggttgtggtggacgccaagagcgaagcggtggtcagt
gaagatttggctcagtcgattgtgttgcgcctaccaccactgtcgacattgttctacaag
ctggtctaa

DBGET integrated database retrieval system