KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03414Help
Entry
VVMO6_03414       CDS       T01415                                 

Definition
malate synthase-related protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_03414
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VVMO6_03414
   00630 Glyoxylate and dicarboxylate metabolism
    VVMO6_03414
Enzymes [BR:vvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VVMO6_03414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:513953..514525
Genome map
AA seq 190 aa AA seqDB search
MNMLTFDKNENQQQRPFIAEAVFAVEAVNSNQQDEKQQKAKQLLDRMFPLESGSHQDVTS
YVIDYRHLMAYFADGSHSGLQAPKHFVAFTGEKEDPCSILLRDESGSHIEVMLGCHKGTG
SVELVDIDDIQLETRTTFSPELTGDAPTAMRHWISLVKGDVNGKPMASSEDKEYTAKSGE
DYVLSYCYSI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgacattcgataaaaatgaaaaccaacaacaacgcccatttatcgctgaa
gctgtatttgccgtcgaagcggtaaattctaatcagcaagatgaaaaacaacaaaaagcg
aaacagcttctcgacagaatgtttccgctagaatctggctcacatcaagacgtaaccagc
tatgtgatcgattatcgccacctgatggcgtattttgcagatggttcccacagtggcctt
caagcacccaaacattttgtcgctttcaccggtgagaaagaagatccttgctctatcttg
ctacgcgatgaatcaggcagccacattgaagtgatgctgggttgccacaaaggcacagga
agtgtggaacttgtcgatatcgatgatattcaattggaaacgcgcacgacctttagccct
gaattaacgggtgatgcaccaacggcaatgcgtcattggatcagtctagtgaaaggcgat
gtgaatggtaagccaatggcaagcagtgaagataaagaatataccgcgaaaagtggtgaa
gattatgtactgagttactgctatagcatctaa

DBGET integrated database retrieval system