KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03855Help
Entry
VVMO6_03855       CDS       T01415                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VVMO6_03855
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VVMO6_03855
Enzymes [BR:vvm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VVMO6_03855
Two-component system [BR:vvm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   VVMO6_03855
Bacterial motility proteins [BR:vvm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VVMO6_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1001901..1002425
Genome map
AA seq 174 aa AA seqDB search
MAAVATVLQRLKDSFCIPILLVQHISASPESYIAAHFDSKSHLSVHEAEDKQPIKNGNMY
IAPPNYHMMIETDGCIALSVDPPVNFSRPSIDVLFETAADYYRNALIGIVLTGANSDGAL
GLKKIKTLGGLTLVQSIDSAEAKAMPAAAMAAVDVDHILSLEDIGHYLNTLCDC
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttggccgccgttgcaacggtattacagcgacttaaggattcattttgtatccctattttg
ttggttcagcatatcagtgcctctcctgagagttacattgccgcccattttgatagcaag
agccatttgtcggtccatgaggcagaagacaagcagccaatcaaaaacggcaacatgtac
atcgcaccacccaattaccatatgatgatagagaccgatggttgtatcgcactgtcggtc
gatccgcccgtcaatttttcacggccttccatcgacgtgctgttcgaaacggcggctgat
tattatagaaacgcgttgatcggtatcgtattgacaggcgctaattccgacggtgcctta
ggtctcaaaaaaatcaaaacactgggtggactaaccctagtccaatccattgatagtgca
gaagcgaaagccatgcctgccgcggccatggctgccgttgatgtcgaccacatcctttct
ttggaagatattggtcattatttaaatactttatgtgattgctga

DBGET integrated database retrieval system