KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03940Help
Entry
VVMO6_03940       CDS       T01415                                 

Definition
(GenBank) dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00010  Glycolysis / Gluconeogenesis
vvm00020  Citrate cycle (TCA cycle)
vvm00620  Pyruvate metabolism
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
vvm01200  Carbon metabolism
Module
vvm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVMO6_03940
   00020 Citrate cycle (TCA cycle)
    VVMO6_03940
   00620 Pyruvate metabolism
    VVMO6_03940
Enzymes [BR:vvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VVMO6_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV88962
Position
II:1108714..1109859
Genome map
AA seq 381 aa AA seqDB search
MKTFILPDLGEGLAESEIIKWHVSVGDKVEVDQVILTVETAKATVDVPAPWAGTIITRHG
NEGDVVNIGALLLEIEDGDVTANSDKKVQQREDAATVVGHVSNQMHQVKVDDFWIGGNQN
HTTEKRVTALPSARLLAQKLGVNLEMVSGTGPSGLIMDHDVYDEAGKQRPGTEVLKGARR
TMMTAMTESHLQVAAVTITEEALLEHWSSQEDISVRLVQAVVYACQQEPALNAWFDADTI
TRCVHHTVNIGVAVDSAHGLYVPVMRHADEFSPDDIRSWINQTVSGIRERKIGREQLQHA
TITLSNFGAIAGIYATPVVSPPQVAIVGAGRIIEKVVLREGKAVAVKAMPLSITFDHRAC
TGGEAARFTKALAEHLRKPSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttatcctaccggatcttggcgaagggctcgctgagtcggaaattattaag
tggcacgtcagcgtcggtgacaaagtggaagtcgaccaagtgatcctcaccgtggaaacc
gccaaggcaacggttgatgtaccagccccatgggcaggaaccattattactcggcatggc
aatgaaggcgatgtggttaacataggggcgctgttactggaaatcgaagacggtgatgtg
accgcaaacagcgacaaaaaagtgcaacaacgcgaagacgccgccacggtggtgggtcat
gtgtccaatcagatgcatcaagtgaaagtggacgatttttggatcgggggcaaccaaaac
cacaccacagagaaacgggtgaccgccttgccatcggctcgtttgctggcgcaaaaactc
ggggtgaacttggagatggtgtctggtactggcccatccggtttgattatggatcacgat
gtctacgacgaagcgggcaaacaacgccccggaacggaagtgctcaaaggggcacgacgc
accatgatgaccgcgatgaccgaatctcatctgcaagtggctgcggtcaccattactgag
gaagcgctgttagagcattggagcagtcaagaagacatttccgttcgtttggttcaagcg
gtcgtttacgcctgccagcaagaacccgcattaaacgcatggtttgatgctgataccatc
acacgttgcgtgcaccataccgtgaatattggtgtggctgtggacagtgcccacggtttg
tatgtccctgtgatgcggcatgccgatgaattttcacccgacgatattcgtagctggatc
aatcaaaccgtttcagggattcgcgagcgcaaaattggccgtgagcagttgcaacacgct
acgatcaccctgtcgaattttggtgccatcgccggtatttatgccacgcctgtggtgtca
ccgccgcaagtggcgattgtgggggcaggtcgaatcattgagaaagtggtgcttcgggaa
ggaaaagccgtggccgtcaaagcaatgcctttgtcgatcacctttgaccatcgtgcttgt
acgggtggcgaagccgcgcgctttactaaagcgttggcagagcatttaagaaaacccagt
gtgtaa

DBGET integrated database retrieval system