KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03940Help
Entry
VVMO6_03940       CDS       T01415                                 

Definition
dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_03940
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVMO6_03940
   00020 Citrate cycle (TCA cycle)
    VVMO6_03940
   00620 Pyruvate metabolism
    VVMO6_03940
Enzymes [BR:vvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VVMO6_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1108714..1109859
Genome map
AA seq 381 aa AA seqDB search
MKTFILPDLGEGLAESEIIKWHVSVGDKVEVDQVILTVETAKATVDVPAPWAGTIITRHG
NEGDVVNIGALLLEIEDGDVTANSDKKVQQREDAATVVGHVSNQMHQVKVDDFWIGGNQN
HTTEKRVTALPSARLLAQKLGVNLEMVSGTGPSGLIMDHDVYDEAGKQRPGTEVLKGARR
TMMTAMTESHLQVAAVTITEEALLEHWSSQEDISVRLVQAVVYACQQEPALNAWFDADTI
TRCVHHTVNIGVAVDSAHGLYVPVMRHADEFSPDDIRSWINQTVSGIRERKIGREQLQHA
TITLSNFGAIAGIYATPVVSPPQVAIVGAGRIIEKVVLREGKAVAVKAMPLSITFDHRAC
TGGEAARFTKALAEHLRKPSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttatcctaccggatcttggcgaagggctcgctgagtcggaaattattaag
tggcacgtcagcgtcggtgacaaagtggaagtcgaccaagtgatcctcaccgtggaaacc
gccaaggcaacggttgatgtaccagccccatgggcaggaaccattattactcggcatggc
aatgaaggcgatgtggttaacataggggcgctgttactggaaatcgaagacggtgatgtg
accgcaaacagcgacaaaaaagtgcaacaacgcgaagacgccgccacggtggtgggtcat
gtgtccaatcagatgcatcaagtgaaagtggacgatttttggatcgggggcaaccaaaac
cacaccacagagaaacgggtgaccgccttgccatcggctcgtttgctggcgcaaaaactc
ggggtgaacttggagatggtgtctggtactggcccatccggtttgattatggatcacgat
gtctacgacgaagcgggcaaacaacgccccggaacggaagtgctcaaaggggcacgacgc
accatgatgaccgcgatgaccgaatctcatctgcaagtggctgcggtcaccattactgag
gaagcgctgttagagcattggagcagtcaagaagacatttccgttcgtttggttcaagcg
gtcgtttacgcctgccagcaagaacccgcattaaacgcatggtttgatgctgataccatc
acacgttgcgtgcaccataccgtgaatattggtgtggctgtggacagtgcccacggtttg
tatgtccctgtgatgcggcatgccgatgaattttcacccgacgatattcgtagctggatc
aatcaaaccgtttcagggattcgcgagcgcaaaattggccgtgagcagttgcaacacgct
acgatcaccctgtcgaattttggtgccatcgccggtatttatgccacgcctgtggtgtca
ccgccgcaagtggcgattgtgggggcaggtcgaatcattgagaaagtggtgcttcgggaa
ggaaaagccgtggccgtcaaagcaatgcctttgtcgatcacctttgaccatcgtgcttgt
acgggtggcgaagccgcgcgctttactaaagcgttggcagagcatttaagaaaacccagt
gtgtaa

DBGET integrated database retrieval system