KEGG   Vibrio vulnificus MO6-24/O: VVMO6_04551Help
Entry
VVMO6_04551       CDS       T01415                                 

Definition
chemotaxis protein CheD (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VVMO6_04551
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VVMO6_04551
Enzymes [BR:vvm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VVMO6_04551
Two-component system [BR:vvm02022]
 CheA family
  CheA-CheYBV
   VVMO6_04551
Bacterial motility proteins [BR:vvm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VVMO6_04551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1798921..1799955)
Genome map
AA seq 344 aa AA seqDB search
MNKKMKVLVVDDSPVFRALLSEIINSDPQLEVIGAAEDPYQAREMIKALKPDVLTLDIEM
PKMNGVQFLKNLMRLHPLPVVMISTLTQHGADATLMALELGAVDYFPKPSVANTADMLGY
RSLVNEKIRMAAQAQVGANQSMSPAVASSSAVSTSQYQLIAIGASTGGTEAVKHLLSALP
ASMPPIVITQHISAMFSGPFASRLDASCALSVSELTQGEVALKANHAYVAPGDKHLMVFR
RGGQLYAHLDDSPAVNRHKPSVDVMFGSVAESLKGKAIGVILTGMGKDGAQGMLQMKQQG
AITVAQDEQSCVVYGMPRAAVECGAAMHIKPLNKLPQFLCDLLS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagatgaaagtcttggtggtggatgattcacccgtgttcagagccttgctc
tcggagatcattaattcggatcctcaattggaagtgatcggcgcggctgaagatccttat
caagcgcgtgagatgatcaaagccttaaagccagatgtgctgaccctcgacatcgaaatg
cccaagatgaatggcgttcagtttctcaaaaatcttatgcgcctgcatcctttgcccgtg
gtgatgatctcaacgctcacccagcatggcgcagacgcgacactcatggctttagagctt
ggcgcggtggattattttcccaaaccatcggtggccaataccgccgatatgctgggttat
cgcagcttagtgaacgaaaaaatccgcatggccgctcaggcgcaagtgggggcgaatcaa
agcatgtcgccagcggtggccagcagcagtgcggtttccactagccaatatcagctcatt
gccattggcgcgtccaccggagggaccgaggctgtgaaacatctgctctcagccttgcca
gccagcatgccaccgattgtgattacccaacacatcagcgcgatgttttctggtccgttt
gccagccgattggacgccagttgtgcattgagtgtcagtgaactcactcagggggaagtt
gctttaaaagccaatcatgcctacgttgcgccgggggacaaacacttaatggtgtttcgc
cgcggagggcagttgtatgcccatttggatgacagcccggcggtgaatcgacacaagcct
tcggtggatgtgatgtttggctcagtcgcggaaagtttaaaaggcaaagcgataggcgtg
atcctcactggaatggggaaagatggcgcgcaaggcatgttgcagatgaagcagcaaggt
gccatcaccgtggcgcaagatgagcagagttgcgtggtgtatggcatgccgcgggctgcg
gtggagtgtggcgccgccatgcacatcaaaccactcaataaacttcctcagtttttgtgc
gatctactaagctaa

DBGET integrated database retrieval system