KEGG   Vibrio vulnificus CMCP6: VV1_0155Help
Entry
VV1_0155          CDS       T00108                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00020  Citrate cycle (TCA cycle)
vvu00640  Propanoate metabolism
vvu00660  C5-Branched dibasic acid metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
Module
vvu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vvu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VV1_0155
   00640 Propanoate metabolism
    VV1_0155
   00660 C5-Branched dibasic acid metabolism
    VV1_0155
Enzymes [BR:vvu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VV1_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AAO08693
UniProt: Q8DFQ1
Position
I:complement(142616..143782)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRATRK
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLQGDQIKQFVKI
FMGLGEMFTQYDLALLEINPLVITGEGNLLCLDGKINIDSNALYRQPKLREMHDPSQEDK
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVSVPVVVRLEGTNADLGRKV
LAESGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttgccggtacca
gaaggttatgcttgtgatacacctcaagaagcatttgaagctgctggccgcattagcacc
gcgaagaaagttgtaaaatgtcaggttcacgcaggtggccgcggtaaagcgggtggcgta
gagcttcacgatacgaaagaaggcgtgaaagaatttgcacaaaaatggcttggcaaaaac
ctggtaacttatcagacagatgcgaatggtcagccagtaacaaaaattttggttgaagaa
gcgtccaatattgccaacgagctatacttgggtgctgtcgttgaccgtgcaacacgtaaa
gtcgttttcatggcctcaactgaaggcggtgtggaaatcgaaaaagttgcagaagaaaca
cctgaactgattcacaaagcggctattgatccactggtaggccctcaggcttatcaaggt
cgtgagcttgcatttaaacttggtcttcaaggcgatcaaattaagcagtttgtgaaaatc
ttcatgggtttgggtgaaatgttcactcaatacgatctcgctcttcttgaaatcaaccca
cttgtgattactggtgaaggcaacctactttgtctagatggtaagatcaacatcgactca
aatgcgctttaccgccaacctaaactgcgtgaaatgcacgatccttctcaagaagataag
cgtgaagctcatgcggcgcagtgggaactgaactacgtagcacttgatggtaacgtcggc
tgtatggtgaacggtgcaggccttgcaatgggtactatggacatcgtaaacctacacggt
ggcaaaccagccaacttcttggatgtaggtggcggcgcgacaaaagagcgtgtagcagag
gcattcaagatcatcctttctgatgacaatgtaaaagccgttttggtgaacatctttggt
ggtattgttcgttgtgacatgatcgcagaaggtatcatcggcgcggtaaaagaagttggt
gtaagcgtacccgttgttgtacgccttgaaggtactaatgcggatcttggccgcaaagta
ctggcagagtcaggtttggatatcattgcagcagaatcactaacagatgctgctcagaaa
gtagttgctgcggcggagggcaaataa

DBGET integrated database retrieval system