KEGG   Vibrio vulnificus CMCP6: VV1_0183Help
Entry
VV1_0183          CDS       T00108                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV1_0183 (asnB)
Enzymes [BR:vvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VV1_0183 (asnB)
Peptidases [BR:vvu01002]
 Cysteine Peptidases
  Family C44
   VV1_0183 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:172624..174288
Genome map
AA seq 554 aa AA seqDB search
MCSVFGILDIKSDAAALRPIALEMSKKLRHRGPDWSGIYASDRAILAHERLAIVGLNSGA
QPLYSPDKKLILAVNGEIYNHKEIRARYEGKYDFQTDSDCEVILALYQEMGADLLEELNG
IFAFVLYDEEKDQYLIGRDHIGIIPLYQGYDEHGNYYVASEMKALVPVCKTISEFPPGSY
YSSTDAGPQRYYIRDWNEYAAVQGNTSSKEELTAALEAAVKRQLMTDVPYGVLLSGGLDS
SITSAVAKRYAAMRIEDDEQTEAWWPQLHSFAIGLDGAPDLKAAREVAAKIGTVHHEMTY
TIQEGLDAIRDVIYHIETYDVTTIRASTPMYLMGRKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAQEFHEETVRKLLALNMFDCARANKSLAAWGVEGRVPFLDKEFIDVAMRLNPAD
KMCGNGKMEKHILRECFEHYLPDSIAWRQKEQFSDGVGYGWIDTLKAVAEEKVTDQQMEA
AKFRFPYNTPTTKEGYVYREIFEELFPLTSAAECVPGGPSVACSSAKAIEWDESFKNCID
PSGRAVKAVHNEAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcagtatttggcattttagacattaaaagcgacgcagcggcgcttcgccctatc
gctttagagatgtcgaaaaaacttcgtcaccgtggcccagactggtccgggatctacgca
tcagatcgagcaattcttgctcatgagcgtcttgcgatcgtaggtcttaacagcggcgca
cagcctctttacagcccagataaaaaactcatccttgccgttaacggtgaaatctacaac
cacaaagaaattcgtgctcgttacgaaggcaaatatgatttccaaacagattctgattgt
gaagttattctcgccctctaccaagaaatgggtgccgatctcctagaagaattaaacggt
atcttcgcttttgttctttacgatgaagagaaagatcagtacctaattggacgtgaccac
attggtatcatcccgctttaccaaggttatgatgagcacggcaactactatgtcgcttca
gaaatgaaagcgttggttcccgtttgcaaaaccatcagtgaatttcctccaggtagctac
tacagctcaaccgatgcaggtcctcaacgttactacattcgcgactggaatgaatacgca
gcggtacagggcaacaccagcagcaaagaggaactaacagcagcgcttgaagcggcggtg
aaacgtcagttgatgacagatgtgccttacggtgtattactgtcgggtggacttgattct
tctattacctctgcggttgctaaacgttatgccgcaatgcgaattgaagacgacgaacaa
actgaagcctggtggccacaacttcactcatttgctattggccttgacggtgctccagat
ctgaaagcagcccgtgaagtggcggcgaaaattggcactgtacaccatgaaatgacgtac
accattcaagaaggattggacgcaattcgtgatgtgatttaccacatcgaaacatacgat
gtcacgaccatccgcgcgtcaacaccaatgtatttgatgggacgtaagatcaaagccatg
ggcatcaagatggtactttctggtgaaggggctgacgagatttttggtggctacctctac
ttccacaaagcacccaacgcacaagagttccacgaagagacggtgcgcaaactgcttgcg
ctcaacatgtttgactgtgctcgcgcaaacaaatcgctagcggcttggggtgttgaaggc
cgagtgccattcttggataaagagtttatcgatgttgcaatgcgcttgaaccctgcggat
aaaatgtgtggcaacggcaaaatggagaaacacattcttcgtgagtgctttgagcactac
ctaccagactctattgcttggcgtcaaaaagagcagttttctgatggcgtgggttatggc
tggatcgacacactcaaagcagtggcagaagagaaagtaaccgatcaacagatggaagcc
gcaaaattccgcttcccatacaacacgccaacaacaaaagaaggctatgtataccgcgaa
attttcgaagagttgttcccactgacatcggctgcagaatgtgtccctggcggtccatca
gtggcttgttcgtccgctaaagcgattgaatgggacgaatcctttaaaaactgtattgac
ccgtcaggtcgagcagtgaaagcggtacataacgaagcgtattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system