KEGG   Vibrio vulnificus CMCP6: VV1_0450Help
Entry
VV1_0450          CDS       T00108                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV1_0450 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV1_0450 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    VV1_0450 (aceB)
Enzymes [BR:vvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VV1_0450 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(446748..448385)
Genome map
AA seq 545 aa AA seqDB search
MMLAQTPEKENTQAEQQTQGMLEVTGTLSPEHQAIFPVEAQTFLSQLCERFSLRVDQLLT
AREERQNKIDQGELPDFLTETQDIREGSWKILGIPNDLQDRRVEITGPTDRKMVINALNA
NVKVFMADFEDSMSPAWDKVLDGQINLRDAVNGTISYSNPDNGKHYQLGNDPAVLICRVR
GLHLKEKHVTWRGQIIPGSLFDFALYFFNNHKALLKKGSGPYFYLPKLQSHHEAKWWSEV
FHFTEEYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLK
KHPDRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDPQENQKVLDK
IQNDKSLEASNGHDGTWVAHPGLADTAMDVFNRALGERKNQLDVTRQDDAPITAKQLLEP
CDGARTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHSKSL
DNGEVVTKALFKRYLDEEIQVVKQEVGETRFDSGRFHEAAELMASLTTSDELTNFLTVPG
YDYLD
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgctcaaacgcccgaaaaagaaaacacacaggctgaacaacagacccaaggc
atgcttgaagtaacaggaaccctgtctcctgaacatcaagctattttccctgttgaagcc
caaacctttttatctcagctgtgtgagcgattctcattgcgcgtcgatcaattgttaact
gcccgtgaagagagacagaacaagatcgatcaaggagagttacctgattttcttacagag
actcaggatattcgagaagggagctggaaaattttggggattcccaacgatctgcaagat
cgtcgagtcgaaattaccgggccaaccgatcgtaaaatggtgatcaacgccctaaacgcc
aatgtaaaagtctttatggcggatttcgaagactcgatgtctccagcttgggataaggtg
ttggatggccagatcaacttgcgtgatgcggtcaatggcaccatctcctattccaacccc
gataatggcaagcattatcagctgggcaacgatccagcggtgttgatctgccgtgtccgc
ggtcttcatttaaaagaaaagcatgtgacgtggcgcggtcagatcattccaggttcctta
tttgattttgctctttatttctttaacaaccacaaagcgttgttgaaaaaaggcagtggt
ccttatttctatcttcctaagttacagtctcatcatgaggcgaaatggtggagtgaagtg
ttccatttcaccgaagagtatttcggtttggatactggcactatcaaagccacggtattg
atcgagacgctgcctgccgtctttgaaatggatgagattctcttctcgttaaaagagcat
attgttggcctcaactgtggccgttgggattacatttttagctatatcaaaacactgaaa
aagcacccagaccgtgtgctgcctgatcgtcaggtggttaccatggacaagccgttcctc
aatgcttactcgcgtttacttgtccgcacctgtcataaacgtggcgcgtttgcgatggga
gggatggctgcctttatcccagccaaagatccacaagagaatcaaaaggtattggataag
atccagaacgataaatcactcgaagccagcaatggccatgatggcacttgggttgcgcat
cctggtttagccgacaccgccatggacgtgtttaatcgtgctctaggtgagcgtaaaaac
cagcttgatgtcactcgccaagacgatgcgccgattacagctaaacagttacttgagcct
tgtgatggagcaagaacagaacaaggtatgagacacaatattcgtgttgcattgcagtac
atagaggcgtggatctcggggaatggctgtgtaccgatttatggcttgatggaagatgca
gcgaccgcagagatctcacgcgcttctatctggcagtggattcaacatagtaagtcgtta
gataacggtgaagtggtgaccaaagcgttgtttaagcgttatctcgacgaagagattcaa
gtcgtaaaacaagaagtgggggagactcgttttgactcaggccgtttccatgaagccgcc
gaattgatggctagcctgaccaccagtgatgagctaaccaacttcttaaccgtaccgggt
tatgactacctagattaa

DBGET integrated database retrieval system