KEGG   Vibrio vulnificus CMCP6: VV1_0496Help
Entry
VV1_0496          CDS       T00108                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VV1_0496
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    VV1_0496
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VV1_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(493929..494915)
Genome map
AA seq 328 aa AA seqDB search
MGPLWVDVAGYELNAEDKEILQHPSVGGLILFTRNYHDSEQLLALTSAIRQVVKRPFLIG
VDQEGGRVQRFREGFSLIPAAAEYAKQANGEAMAQMGGWLMAAELIAHDIDLSFAPVLDQ
GFGCKAIGNRAFGEDTQTILRHSSAYMQGMKAVGMATTGKHFPGHGGVVADSHLETPFDQ
RSDIVEQDMAIFKTQIDAGLLDAMMPAHVIYPHYDPQPASGSEYWLKQVLRQQLGFKGLI
FSDDLTMEGAAVMGGPADRALQALNAGCDMLLMCNKRDAQVAALDALPIVEVPLALSLLK
KRSFSLSELKLAPQWKEARENMLRILGH
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggggccactttgggttgatgtcgcaggttatgaactgaatgcagaagacaaagaaatt
ttacagcatccatccgttggcggattgatcttatttacccgcaactatcacgatagtgaa
caactgttggcgctcacttctgccattcgccaagtggtcaaacgtccttttctgattggt
gtcgaccaagagggagggcgagttcagcgtttccgtgagggtttttctctgattcccgcc
gcggcagaatatgccaaacaggccaatggggaagcgatggcacaaatgggcggttggctg
atggcggccgaactgattgctcatgatatcgacctgagttttgcccccgtgttagaccaa
ggctttggatgtaaagcgattggcaatcgagcgtttggtgaagatacgcagactattttg
cgccatagcagtgcctacatgcagggcatgaaagcggtggggatggcaacaacgggcaaa
cacttccctggtcatggcggcgtggtggcagattcgcatcttgaaaccccgtttgaccaa
cgaagcgatattgttgagcaggatatggcaatcttcaaaacgcaaatagacgcaggctta
ttagacgccatgatgcccgcgcatgtgatttacccgcattacgatcctcaaccagcgagt
ggttcagaatattggttaaaacaggtattacgccagcaattggggttcaagggcttaatt
ttttctgatgatctcaccatggaaggggctgccgtgatgggaggccctgcagatagggct
ttacaagcattgaatgcgggctgtgacatgcttttgatgtgcaataaacgcgatgcacaa
gtggcagccttggacgcactgcctatagtcgaggttcccttggcattatccttgttgaag
aaacgcagcttcagcctttctgaactgaaattggcgccgcaatggaaagaagcaagagaa
aacatgctacgcatactgggccactaa

DBGET integrated database retrieval system