KEGG   Vibrio vulnificus CMCP6: VV1_0529Help
Entry
VV1_0529          CDS       T00108                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vvu  Vibrio vulnificus CMCP6
Brite
Enzymes [BR:vvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VV1_0529
Secretion system [BR:vvu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VV1_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(530310..531095)
Genome map
AA seq 261 aa AA seqDB search
MSVLRRLTLLTLPLFVTACGAEESQAVETAQPAAQVAASTHFDSEALKARFSKLGLNIMD
IQPSDVAGLVEIQTSGGVLFASNDGSHFIAGTLYAIDENGQYKDVIAERQAPLNAKKIAE
FADSAIEYKAKDEKYVVTVFTDITCGYCVRLHSQMQGYNDLGITVRYMAYPRQGGTGPVA
EQMAGIWCAANPQEAMHDAKVNRKFAPAKNDLQQCKQTVAQHYQLGQQLGITGTPAIFLP
NGELVAGYLPPEKLLERLQQQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgattaactcttttaactcttcctctctttgtgacggcctgcggt
gctgaagaaagccaagctgtcgaaacagctcagccagcggcacaagtggcggcgagcacg
cattttgatagcgaggctctcaaagctcgtttttccaagctgggcctgaacatcatggat
attcaaccttcggatgtggctggtttagtcgaaattcaaaccagtggcggggtgttattt
gcgtctaatgacggtagccactttatcgcaggaaccttgtatgccattgacgaaaatggt
caatacaaggatgtgattgcagaacgccaagcgccgctcaacgccaagaaaattgccgaa
tttgctgacagcgcgatcgagtacaaagccaaagatgaaaaatacgtggtgacagtgttt
accgacattacttgtggttactgcgttcgtctacacagccagatgcagggctacaatgac
ttaggtatcaccgtgcgttacatggcatacccacgccaaggtggcacgggcccagtggca
gaacaaatggcgggcatctggtgtgccgctaatccgcaagaagcgatgcatgatgctaaa
gtgaaccgcaaatttgccccagcgaaaaatgatttacaacagtgcaagcagaccgtggct
caacattaccaacttggtcagcaactcggtattacaggcacgcctgcaattttcttgcca
aatggtgaactggttgctggttacttgccaccagaaaaactgctagagcgcttacagcaa
caataa

DBGET integrated database retrieval system