KEGG   Vibrio vulnificus CMCP6: VV1_0543Help
Entry
VV1_0543          CDS       T00108                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VV1_0543 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VV1_0543 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VV1_0543 (thrC)
Enzymes [BR:vvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VV1_0543 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(543215..544495)
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAELPKFDDIDALLAQDFISRSTAILSAL
IGDELAEDKVNSMVDAAFQFPAPIKQVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
DGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGKWDPKPTVATTSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYSLGYLCEPHGAIAYRVLD
QQLQEGETGLFLCTAHPAKFKEVVDDILGSDIDLPAPLAKHAVMELLSEELDADFTALKE
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaacataaaagaaaatgacgaacaagtttcctttggccaagccgtgcgt
caagggttaggccgtaatcaggggctatttttcccagcagaattaccgaaatttgatgat
atcgatgcgttgcttgcgcaagattttatctcgcgcagcactgcgattctttccgcgttg
attggtgatgagctagcagaagacaaagttaactcaatggtggatgcggcattccaattc
ccagcaccgattaaacaagtgaaagagggtgtctacgcgcttgaactgttccatggaccg
acacttgccttcaaagacttcggtggccgctttatggctcagtcgttggctgcggtttct
gatggtggaaaaatcactattctaacagcgacatcgggtgatacaggagccgcggttgca
cacgctttttacggtatggaagacatcaatgtggtcattctttatccgaaaggcaaaatc
agcccattgcaagaaaagctgttctgcacattaggcaaaaacattcacacggtagcgatc
aatggtgactttgatgcgtgtcaggcgctggtgaagcaagcgtttgatgatgcagagctg
cgtgaagagattggtctaaactctgcaaactcaatcaacattagccgtttgatggcgcaa
atctgctactactttgaagcagcggcacagatgagtaagcaagagcgcgagaatctggtg
gtgtcggtaccaagcggtaactttggtaaccttactgcaggtttgcttgctaaagctctg
ggtttaccgattaagcgctttatcgcggcaacgaatgccaatgataccgtgcctcgttac
ctagaaaccggtaaatgggatccaaaaccgactgtcgcgacgacctcaaatgccatggac
gtgagtcagcctaataactggccacgaattgaagagttgtgccgtgtgaaagagtggggt
ttggaaactttgggcaaaggtgctgtgtctgatgagcaaagtgcgcaatcggtgaaagat
ctctattcacttggttacctgtgtgaaccacatggtgcgattgcctatcgtgtgctggat
cagcagctacaagaaggtgaaactggcttgttcctctgtaccgcacatccggcgaagttt
aaggaagtggtcgatgacattcttggcagtgacatcgatttgccagcaccactggcaaaa
catgcggtgatggaactgctctcagaagagttggatgcggattttacggctctgaaagaa
gtattgcgtcgcgtgcaataa

DBGET integrated database retrieval system