KEGG   Vibrio vulnificus CMCP6: VV1_0583Help
Entry
VV1_0583          CDS       T00108                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vvu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vvu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(598062..599543)
Genome map
AA seq 493 aa AA seqDB search
MRNTMNLTNLLAPWLDCPELADITVQSLELDSRQVKQGDTFVAIVGHVVDGRQYIEKAIE
QGANAVIAQSCQQYPSGLVRYQQNVVIVYLEKLDEKLSQLAGRLYQHPEMSLIGVTGTNG
KTTITQLIAQWLELAGQKAAVMGTTGNGFLNALQPAANTTGNAVEIQKTLADLQQQGAKA
TALEVSSHGLVQGRVKALQFAAGVFTNLSRDHLDYHGTMEAYAKAKMTLFTEHQCQHAII
NLDDEVGAQWFQELQQGVGVSLFPQDASVKALWASSVAYAESGITIEFDGCFGQGRLHAP
LIGEFNATNLLLALATLLALGVDKQALLDSAASLRPVLGRMELFQVNSKAKVVVDYAHTP
DALEKALQALRVHCTGHLWAIFGCGGDRDKGKRPMMAEIAERLADHVVLTDDNPRSEDPT
MIVQDMLAGLTRADSAVVEHDRFSALQYALDNAQADDIILLAGKGHEDYQVLKHQTVHYS
DRESAQQLLGISS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaataccatgaatctgacaaatttattagcgccgtggctagattgtcctgagctt
gcggacattaccgtccaatcgctggagttagacagtcgtcaggtgaaacaaggcgatact
tttgtcgctatcgttggtcacgtggtggatggccgccagtatattgagaaagcaatagaa
cagggcgcaaatgccgtcattgctcaatcttgtcagcaatacccttccggcttggtgcgc
tatcagcaaaacgtggtgattgtctatcttgagaagctggacgaaaaactgtcgcaatta
gcgggacgcctgtaccaacatcctgagatgtcattaattggtgtgacaggaaccaatggc
aaaaccaccatcactcaattgattgcgcaatggctagagttagccgggcaaaaagccgcg
gtgatggggacgacgggcaacggttttctcaatgccttacagcctgcggccaataccacg
ggcaatgcggttgagattcaaaaaacgttggcagacttacagcagcaaggggcaaaagca
actgcgttggaagtctcttctcatggcttagtgcaggggcgcgttaaggcgctacagttt
gcagctggcgtgtttaccaatctgagtcgtgatcatttggattatcacggcacgatggaa
gcctatgccaaagccaaaatgacgctgtttactgagcaccagtgccagcatgcaatcatc
aatttggatgacgaagtcggtgcgcagtggtttcaagagctgcaacaaggggtcggcgtt
tcattgtttccacaagatgcaagtgtaaaagcactgtgggccagctcggtagcttacgca
gaaagcggtattacgattgagtttgatggctgttttggccaagggcgtctgcacgcgcca
ttgattggtgaatttaatgccaccaacttactgctcgcgttggcaacactgttagcctta
ggcgttgataagcaagctttattggattcggccgcaagcctgcgtccagtacttggacgt
atggaactgtttcaagtgaacagcaaagcaaaagtggtggtcgattatgcacatacccca
gatgcgctggagaaagcgctgcaagcactgcgtgttcactgtaccggtcatttgtgggcg
attttcggctgtggtggtgatcgcgataaaggcaagcgaccaatgatggctgagattgca
gagcgtctggccgatcacgtcgtgcttaccgacgacaacccacgcagtgaagaccccacc
atgattgtgcaagatatgctggcgggcttaacccgtgcggacagtgcggtggttgagcac
gatcgcttcagtgcgcttcaatacgcgctcgacaatgcacaagcggatgacatcattttg
ttggcaggcaaaggccacgaagattatcaagtactcaagcaccagacggttcactactcg
gatcgtgaatcggcgcagcaactgctaggaatttcatcatga

DBGET integrated database retrieval system