KEGG   Vibrio vulnificus CMCP6: VV1_0981Help
Entry
VV1_0981          CDS       T00108                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00071  Fatty acid degradation
vvu00280  Valine, leucine and isoleucine degradation
vvu00281  Geraniol degradation
vvu00310  Lysine degradation
vvu00362  Benzoate degradation
vvu00380  Tryptophan metabolism
vvu00410  beta-Alanine metabolism
vvu00640  Propanoate metabolism
vvu00650  Butanoate metabolism
vvu00903  Limonene and pinene degradation
vvu00930  Caprolactam degradation
vvu01040  Biosynthesis of unsaturated fatty acids
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
vvu01212  Fatty acid metabolism
Module
vvu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VV1_0981 (fadB)
   00650 Butanoate metabolism
    VV1_0981 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VV1_0981 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VV1_0981 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VV1_0981 (fadB)
   00310 Lysine degradation
    VV1_0981 (fadB)
   00380 Tryptophan metabolism
    VV1_0981 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VV1_0981 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VV1_0981 (fadB)
   00281 Geraniol degradation
    VV1_0981 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VV1_0981 (fadB)
   00930 Caprolactam degradation
    VV1_0981 (fadB)
Enzymes [BR:vvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VV1_0981 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VV1_0981 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VV1_0981 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VV1_0981 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO
Motif
Other DBs
NCBI-ProteinID: AAO09471
UniProt: Q8DDK6
Position
I:983284..985455
Genome map
AA seq 723 aa AA seqDB search
MIYQAETLQVKEVQDGVAEILFCAPNSVNKLDLATLASLDKALDALTAHSGLKGVMLTSD
KEAFIVGADITEFLGLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCEC
VLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRAEEALK
IGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSALTLSKLEAMMSFTMAKGLV
AQVAGPHYPAPMTAVVTIEEGARFARNQALDIERKHFVKLAKSEEAKALVGLFLNDQYIK
GIAKKAAKSANKETQRAAVLGAGIMGGGIAYQSALKGVPVIMKDIAQASLDLGMTEASKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVEAVVENPKVKAAVLSEVEEQVS
EETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFEANKYGQKNGSGFYTYTMDKKGK
PKKAFSDEIVPILAPVCAAQQAFDDQTIIQRMMIPMINEVVLCLQEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVELGAMYQVPQMLIDMAEKGQTFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgaaaccctacaggtaaaggaagtacaagatggagtggcagaaatc
cttttctgcgcgccaaattccgtcaataagctcgatctagcaacccttgcttcactcgac
aaagcgcttgatgcgctcaccgctcactccggtctgaaaggcgtaatgcttacatcagac
aaagaagcctttattgtcggagcagatatcactgagtttttaggactgtttgccaagcca
gaagaagagctcgaccaatggcttcaatttgccaatagcatcttcaataaattggaagat
ttgcccgttccgactgtcgcggttgtcaaagggcataccttaggcggtggatgtgagtgt
gtacttgctaccgatttacgcattggtgataaaaccaccagcattggtcttcctgaaacc
aaactcggcattatgcctggctttggcggttgtgtgcgtttgccgcgcgtgatcggcgca
gacagcgccatggaaatcatcactcaaggcaaagcttgccgtgcagaggaagctctaaaa
attggtttgcttgatgctgtcgtcgattccgatcgcctctacgcatccgccctgcaaaca
ctcaccgatgccatcaatgaaaaaattgactggaaagcacgtcgccagcaaaaaacctca
gcgttaacgctaagcaaactcgaagcgatgatgagtttcaccatggccaaaggcttggtg
gctcaagtagcagggccccactaccctgcaccaatgaccgccgttgtcacgattgaagaa
ggtgcccgttttgcacgcaatcaagcgttagacatcgaaagaaaacatttcgttaaactg
gcgaagtcagaagaagccaaggccttggtgggtcttttcctcaatgaccaatacatcaaa
ggcatcgcgaagaaagcagcaaaatccgccaataaagagacccaacgtgcagcagtgctg
ggcgcaggtattatggggggcggcatagcctaccaatctgctctcaaaggtgtgcccgtg
atcatgaaagacatcgcccaagcatcactggatctgggcatgacggaagcgtcaaagcta
ctcaataaacagcttgaacgtggcaagattgatggctttaaaatggccggcattctcgct
tctattacaccaagccttcactacgcgggcatcgataacgccgatatcattgttgaagcc
gtggtcgaaaacccgaaagtgaaagcagccgtgttaagtgaagtggaagagcaagtgagc
gaagagaccgttctcacctcgaacacctcgaccattccaattaacttgctggccaaatca
ctcaaacgaccagagaacttctgtggtatgcacttcttcaacccagtgcatcgcatgcct
ttagtcgaaatcattcgtggcgaacacacctccgatgaaaccatcaaccgtgtcgttgct
tacgcagccaaaatgggcaaatccccaatagtggtcaatgactgcccagggttctttgtg
aaccgcgtgctgttcccatactttggcggttttagcatgttgctgcgcgatggtgccgac
ttcactcaaatcgataaagtgatggaacgtaaattcggttggccaatgggccctgcttac
ttattggatgtggtcggtattgataccgcacaccacgctcaagccgtcatggcgcaaggg
ttccctgagcgcatgggtaaacaaggtcgcgatgcgattgatgccttgtttgaagccaac
aagtatggccagaaaaacggcagcggtttctacacgtacaccatggacaagaaaggcaaa
ccgaagaaagcattcagtgatgagatcgtaccgattcttgctcctgtttgtgccgctcaa
caagcctttgatgatcaaaccattatccaacgcatgatgattccgatgatcaacgaagtg
gtgctttgcttgcaagaaggcatcatcgcctcagcgcaagaagcggatatggcgctggtg
tatggccttggtttccctcctttccgtggtggtgtattccgctacttagatagtgttggt
attgcaaactttgtcgcaatggcacagcagcatgttgaacttggcgctatgtatcaggtt
ccacaaatgcttattgatatggctgaaaaagggcaaaccttttacggcgcgcaacagcaa
ggttctatctaa

DBGET integrated database retrieval system