KEGG   Vibrio vulnificus CMCP6: VV1_1257Help
Entry
VV1_1257          CDS       T00108                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV1_1257 (pfkA)
   01230 Biosynthesis of amino acids
    VV1_1257 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1_1257 (pfkA)
   00030 Pentose phosphate pathway
    VV1_1257 (pfkA)
   00051 Fructose and mannose metabolism
    VV1_1257 (pfkA)
   00052 Galactose metabolism
    VV1_1257 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VV1_1257 (pfkA)
Enzymes [BR:vvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VV1_1257 (pfkA)
Protein phosphatases and associated proteins [BR:vvu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VV1_1257 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1242051..1243013
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGLYEGRIKQLDRSSVSD
VINRGGTFLGSARFPEFKEVAVREKAIENLKAHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIESIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKEKLIGNIQDGISKGKKHAIIALTELMMDANELAKEIEAGTG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLFKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttgacaagtggtggtgacgcccctggtatgaacgcagca
atccgtggtgtggtacgtactgcactgggtgctggtcttgaagtttatggtatctatgat
ggctacctaggcttgtacgaaggccgtattaaacaacttgatcgttcaagcgtttctgat
gtgattaaccgtggtggtacgttcttgggatcagctcgtttcccagaatttaaagaagtt
gcggtacgtgaaaaagcgattgaaaacctaaaagcacacggtattgatgcgcttgtggtt
atcggcggcgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtctaccaggcacgattgacaacgatatcgcaggtacggattacaccatcggttac
ctaacggcgctgaacacggttatcgaatcgatcgaccgtctacgcgatacttcatcttct
caccagcgtatttctatcgtagaaatcatgggtcgtcactgtggtgacctcactctgatg
tctgctatcgcaggtggctgtgaatacatcatcacaccagaaactggcctagataaagag
aagctgattggcaacatccaagacggcatttctaaaggtaagaaacatgcgatcatcgcg
ctgactgagctgatgatggacgcgaacgaactggcaaaagagatcgaagcgggaacgggt
cgtgaaactcgtgccacggttcttggtcacatccaacgtggtggccgtccaacggcgttc
gaccgtgttcttgcgtctcgtatgggtaactacgcggttcacctattgatggaaggtcat
ggtggccgttgtgttggtatcgtgaaagagcaacttgttcaccacgacatcatcgatgca
atcgagaacatgaagcgtccagttcgcaatgatctgttcaaagtagcagaagagctattc
taa

DBGET integrated database retrieval system