KEGG   Vibrio vulnificus CMCP6: VV1_1343Help
Entry
VV1_1343          CDS       T00108                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00010  Glycolysis / Gluconeogenesis
vvu00051  Fructose and mannose metabolism
vvu00562  Inositol phosphate metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
vvu01230  Biosynthesis of amino acids
Module
vvu_M00002  Glycolysis, core module involving three-carbon compounds
vvu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1_1343 (tpiA)
   00051 Fructose and mannose metabolism
    VV1_1343 (tpiA)
   00562 Inositol phosphate metabolism
    VV1_1343 (tpiA)
Enzymes [BR:vvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VV1_1343 (tpiA)
Exosome [BR:vvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VV1_1343 (tpiA)
  Exosomal proteins of bladder cancer cells
   VV1_1343 (tpiA)
  Exosomal proteins of melanoma cells
   VV1_1343 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM MeMO_Hyd_G Ntox27
Motif
Other DBs
NCBI-ProteinID: AAO09797
UniProt: Q8DCQ3
Position
I:complement(1327339..1328109)
Genome map
AA seq 256 aa AA seqDB search
MRRPVVMGNWKLNGSKTMVAELLTGLNAELEGVEGVDVAVAPPALYIDLAERLIAEGGNK
IILGAQNTDINNSGAFTGDMSPAMLKDFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLKPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHASIRAMIAAKDAAVAEQVIIQYGGSVKPENAEAYFAQPDIDGALVGGASLD
AKSFAAIAKAAAKMKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtagtgatgggtaactggaaacttaacggcagcaaaactatggttgct
gaactgctaactggtctaaacgctgaactagaaggcgttgaaggtgtagacgtagcggta
gcgccgccagcactttacatcgaccttgcagagcgcctaatcgctgaaggtggcaacaag
atcattcttggtgcacaaaacactgacatcaacaacagcggtgcattcactggcgacatg
tctcctgcaatgctaaaagactttggtgctactcacatcattattggtcactctgagcgt
cgtgaataccacaatgaatcagatgagttcgtagcgaagaagtttgcattcctgaaagaa
aatggtctaaaaccagttttctgtatcggtgaaactgaagcgcaaaacgaagcaggcgaa
actgaagccgtttgtgcacgtcaaatcaacgcagtgatcgacgcatacggtgttgaagcg
ctaaacggtgccatcatcgcttacgaaccaatctgggcgatcggtacaggtaaagctgca
acagcagaagatgcacagcgtatccacgcctctatccgtgcgatgatcgcagcaaaagat
gctgcagtagcagagcaagtgatcatccaatacggtggttctgttaagccagaaaacgcg
gaagcttacttcgcacaaccagacatcgatggtgctcttgttggtggcgcatctctagat
gctaagagcttcgcagcgatcgcgaaagcagcagcgaaaatgaaagcgtaa

DBGET integrated database retrieval system