KEGG   Vibrio vulnificus CMCP6: VV1_1428Help
Entry
VV1_1428          CDS       T00108                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VV1_1428 (galU)
   00052 Galactose metabolism
    VV1_1428 (galU)
   00500 Starch and sucrose metabolism
    VV1_1428 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VV1_1428 (galU)
Enzymes [BR:vvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VV1_1428 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1411025..1411897)
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMDGMCIVTGRGKH
SIMDHFDKNYELEHQISGTNKEALLEDVRALIDSANFTYIRQREMKGLGHAILTGRELVG
DQPFAVVLADDLCVNEEQGVLAQMVALFKQFRCSIVAVQEVPENETHKYGVISGEMIKDD
LFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGRRFDCGSVEGYIEATNYCYQNLYLKDEKTSELGKFSTQKEK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgccttttccctgccgctggctacggcactcgcttcttacctgcgacc
aaatcgatgccaaaagaaatgatgccagtggtgaacaaacctctgatcgaatacggtgtg
gaggaagccatccaagcgggtatggacggaatgtgcattgttactggtcgtggtaagcat
tcaatcatggatcacttcgataaaaactacgaattagaacatcagattagtggtaccaac
aaagaagccctattggaagatgtacgtgctttgatcgactccgcgaactttacctacatt
cgccagcgtgaaatgaagggcttagggcacgccatcttaacgggccgtgaactcgttggg
gatcaaccttttgccgtcgtactggctgatgacctttgtgtcaatgaagaacaaggtgtc
ttggcacaaatggtcgcgctgtttaagcagttccgctgttcgatcgttgctgttcaggaa
gtacctgaaaatgaaactcataaatacggcgtgatctctggcgaaatgatcaaagacgat
ctcttccgcgtagacaacatggtggagaagccagaacctggtaccgcgccaagtaatctt
gcaattattggtcgttacattcttaccccagatatttttgatctgattgagcaaactgaa
ccaggtaaaggcggggaaattcaaatcaccgacgcactactcaaacaagcaaaagcaggt
tgtgtattggcatataagtttaaaggtcgtcgttttgattgcggcagcgttgaaggctat
atcgaagcaaccaactattgctaccaaaacctttatctgaaagatgagaagacgtctgaa
ttgggtaaattcagtacgcaaaaagagaagtaa

DBGET integrated database retrieval system