KEGG   Vibrio vulnificus CMCP6: VV1_1517Help
Entry
VV1_1517          CDS       T00108                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV1_1517
   00330 Arginine and proline metabolism
    VV1_1517
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    VV1_1517
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     VV1_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1492409..1493329
Genome map
AA seq 306 aa AA seqDB search
MKPTKELLNEILHEVRPLIGRGKVANYIPALARVPAHKLAIAVYTNQGEVIKAGDADEAF
SIQSISKALSLTLAMGLYQPDEIWRRVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIV
VADLLASRLSAPRQRLLEFVRQLSGETHICYDKVVAASEMMHSDRNAAIAYLMRSFGNFE
NEVIPVLNNYFHACALKMSCVDLAKTFSYLANKGVSVHTDQRVISPVQTKQLNALLATCG
LYDGAGEFAYRVGMPGKSGVGGGIIAIVPGEMTIAVWSPELDPSGNSLAGTKALELLSER
IGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaacaaaagaactgctcaacgaaattttgcatgaagttcgccctttgattggg
cgtgggaaagtcgccaactatattcctgctttggccagagtgccggcgcataagcttgct
atcgcggtgtacaccaatcaaggtgaggtgatcaaagcgggagatgccgatgaggcgttc
tcgattcaatccatttctaaggcgctgagtttaactctcgccatgggcctgtatcagccg
gacgaaatttggcgtcgagtgggcaaggagccttctggacaggcgtttaactcgctgatt
cagttagaaatggagcaggggattccgcgcaacccgttcattaatgcgggggcgattgtg
gtggccgatctgctggccagccgtttatctgcgccacgccagcgtttgctggaatttgtc
cgccagctttctggtgaaacgcatatctgttacgacaaagtggtggcggcctctgaaatg
atgcacagcgaccgcaatgcggccattgcctatctgatgcgctcatttggcaattttgag
aacgaagtgatcccggtgttgaacaactacttccatgcttgcgcattgaaaatgagttgt
gtcgatttggctaagacctttagttatttagcgaacaaaggcgtgtcggtacacacagac
caacgcgttattagcccagtgcaaactaaacagctcaatgccttattggcaacctgtggc
ttgtacgatggggcgggggagtttgcgtatcgcgtgggaatgccgggcaaatcgggcgtg
ggcggcgggatcatcgccatcgtgccgggggaaatgaccattgcggtttggtcaccagag
ttagacccgtcaggaaactcgttagcgggcacgaaagcgctagagttgctttctgagcga
attgggcgttcgattttttaa

DBGET integrated database retrieval system