KEGG   Vibrio vulnificus CMCP6: VV1_1584Help
Entry
VV1_1584          CDS       T00108                                 

Definition
tRNA pseudouridine synthase D (EC:4.2.1.-)
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
vvu  Vibrio vulnificus CMCP6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1555969..1557012
Genome map
AA seq 347 aa AA seqDB search
MTDTLASLAYLAGKPTAQAKIKAKPEHFQVREDLGFEFTGSGEHLMVRIRKTGENTSFVA
NELAKACGVKSKDVSWAGLKDRHAVTEQWLSVHLPKAETPDFSAFLAQYPSIEILTTARH
NKKLRPGDLVGNDFVVTLSEVSDVDDVLKRLETVAKLGVPNYFGNQRFGNNGNNLQEAKR
WGRDNVRSRNQNQRSLYLSAARSWIFNLIVSARLEQSLFDKVLLGDILFKGDEQLLVSAE
NHADLQSQYDAGDLVISGALAGDNALPTQDDALALEQVFLDAEPDLMALIRGNRMRHDRR
AIALKPANLSWQVDGNNIILTFSLDAGSFATSIIRELVQEIAFEREF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacagacactttggcttctctggcctatttagcgggtaaaccaaccgcacaagcaaaa
atcaaagcaaaaccagaacattttcaggtaagagaagacttaggttttgagttcactggt
tctggtgagcacttgatggtgcgcattcgaaaaactggtgagaacacctcctttgttgcc
aatgaattggcgaaagcatgtggcgtgaaatcaaaagacgtcagttgggctggcttgaaa
gatcgccacgcggtgacggaacaatggcttagtgtccatttgcctaaagcggaaacaccg
gatttttccgctttcctcgcacagtacccatcgattgaaattctcacgaccgctcgtcat
aacaagaaattacgtcctggagaccttgttgggaacgattttgttgtgacgctatccgaa
gtctcggatgtggacgatgtgctcaaacgtctagagacggttgcaaaactcggtgttcca
aattacttcggtaatcagcgttttggtaacaatggcaataacctgcaagaagcaaaacgt
tggggtagagacaatgttcgtagccgcaatcaaaatcaacgtagcctctacttgtctgct
gcgcgttcgtggatcttcaacttaattgtctcggcgcgacttgagcaatcactgtttgat
aaggttttgcttggcgacatcctgtttaagggggatgaacagctattggtgagtgcagaa
aatcatgcggatctccagtctcaatatgatgctggcgacttggtgatcagtggtgccttg
gctggcgataatgccttgccgactcaagatgacgcgttggcgctagagcaagtgttctta
gatgctgaacccgatcttatggcgctgattcgcggcaatcgcatgagacacgatcgccga
gcgatcgcattgaagccagccaatctcagttggcaagtggatggcaataacatcatcctg
actttctcgctcgatgctggctcttttgctacgtctattatccgcgagctagtacaagaa
atcgcgtttgaaagagaattctaa

DBGET integrated database retrieval system