KEGG   Vibrio vulnificus CMCP6: VV1_1586Help
Entry
VV1_1586          CDS       T00108                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vvu  Vibrio vulnificus CMCP6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1557788..1558414
Genome map
AA seq 208 aa AA seqDB search
MSNPQAERLVHFLAVNGIRDSEVLSAIARVPRECFLSQAMMHQAYDNNALPIGQGQTISQ
PYIVAKMTELLRLKRDSKVLEIGTGSGYQTAVLALLVEHVYSVERIKSLQWDAKRRLKQL
DIYNVSTKHGDGWLGWENKGPFDAIIVTAAAESVPPVLLQQLNDGGRMVLPVGTDEQQLI
LIERQKDQFVSQVIEAVNFVPLIAGDLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcctcaagcagaaagattggttcatttcttagcggtcaatggcatccgtgat
agcgaagtgctatctgccatcgctcgtgtaccgagagagtgttttttgtcacaagctatg
atgcatcaggcttatgacaacaacgcattgcctattggtcaaggtcagacgatctctcag
ccctatattgtggccaaaatgacggaacttttgcgtctcaaaagagacagtaaagtattg
gaaattggcactggatcgggttatcaaaccgcagtattagcgcttctggttgagcatgta
tattctgttgagcgaatcaaatctttacagtgggatgcaaaacgtcgcttaaaacagttg
gatatttacaatgtctcgacgaagcatggcgacggctggcttggttgggaaaataaagga
ccttttgacgcgatcattgtgaccgccgcagcggaaagtgttccaccagtgttacttcaa
caattgaatgatggtggccgcatggtactccctgttggtacggatgagcagcagttgatc
ttgattgagcgtcaaaaagatcagtttgtttcccaagtgattgaagcggtgaactttgtg
ccgctgatcgccggagacttggcataa

DBGET integrated database retrieval system