KEGG   Vibrio vulnificus CMCP6: VV1_1631Help
Entry
VV1_1631          CDS       T00108                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00010  Glycolysis / Gluconeogenesis
vvu00020  Citrate cycle (TCA cycle)
vvu00620  Pyruvate metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
Module
vvu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1_1631 (aceF)
   00020 Citrate cycle (TCA cycle)
    VV1_1631 (aceF)
   00620 Pyruvate metabolism
    VV1_1631 (aceF)
Enzymes [BR:vvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VV1_1631 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AAO10050
Position
I:1600282..1602192
Genome map
AA seq 636 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVSVGDKVEEEQSLITVEGDKASMEVPASQAGIVKEIKVV
AGDKVTTGSLIMVFEVEAAGAPGAAAAAPVPAVAPVAAPAAASELKEVCVPDIGGDEVEV
TEILVAVGDSIAEEQSLLTVEGDKASMEVPAPFAGTLKEIKVAAGDKVSTGSLVMVFEVA
GSGAAAPAPVAAAAPAAAPAAVSGVKEVNVPDIGGDEVEVTEIMVTVGDTVSEEQSLITV
EGDKASMEVPAPFAGTVKEIKVAAGDKVSTGSLIMVFEVAGAAPVAAAAPAQAAAPAQAA
APAPAVAPVAKAEAQATTSDFKENDEYAHASPVVRRLAREFGVNLSKVKGSGRKSRILKE
DVQAYVKDALKRLESGAVAAASGKGDGAALGLLPWPKVDFSKFGETEVQPLSRIKKISGA
NLHRNWVMIPHVTQWDNADITELENFRKEQNAIEAKKDSGMKITPLVFIMKAAAKALEAF
PAFNSSLSDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSEELMVVSKKAR
AGKLTAADMQGGCFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEIKPVWNGKEFAPRLQ
LPLSLSYDHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaattaatgtacctgatatcggtgcggatgaggttgaagttactgagatt
cttgtaagcgttggcgacaaggttgaagaagagcagtctctcattactgtagaaggcgac
aaggcttctatggaagtacccgcctctcaagcgggtattgtaaaagaaatcaaagttgtt
gctggcgataaagtaacaacaggttctctcatcatggtctttgaagttgaagcggccggc
gctccgggtgcagcagcggctgcaccagttcctgctgtagcaccagtcgctgcacctgca
gcagcaagtgaactgaaagaagtttgtgtaccggatatcggtggcgacgaagttgaagtg
actgaaatcctagttgctgttggcgattccatcgctgaagagcaatctctactgacagta
gaaggtgacaaagcttcaatggaagtaccagcaccattcgcaggtactctaaaagaaatc
aaagtggcagcaggcgataaagtgtctactggctcactcgtgatggtatttgaagtggcg
ggttcgggcgcagcagcacctgcaccagttgcagcagcagctccggcggcggctccagca
gcagtctctggagtaaaagaagttaacgttcctgatatcggcggcgacgaagttgaagtc
actgaaatcatggttaccgttggcgatacagtctctgaagagcaatctctgattactgta
gaaggcgacaaagcatctatggaagtacctgcacctttcgctggtacggttaaagaaatc
aaagttgcagctggtgacaaagtttctactggttctctaatcatggtgttcgaagttgct
ggcgcagcgccagttgcagcagcggcacccgctcaagcagcggcacccgctcaagcagca
gctccagctccagcggtagctccagtagcaaaagcggaagctcaagcaacaactagtgat
ttcaaagaaaacgacgagtatgctcacgcatctccagtggttcgtcgtctagctcgcgag
ttcggcgtaaatctttctaaagtgaaaggttctggtcgtaagagccgaatcctgaaagaa
gacgttcaagcttacgtgaaagacgcacttaagcgtcttgagtctggtgcagttgcagcg
gcttctggtaaaggcgatggcgcagcgcttggcctactaccatggccgaaagtggacttc
agcaagttcggtgaaacagaagttcagccactatctcgcattaagaagatctcgggtgca
aacctacatcgtaactgggtaatgatccctcacgttacacagtgggataacgcggatatc
actgagctagaaaacttccgtaaagagcaaaacgcgattgaagcgaagaaagactcgggc
atgaagatcacgccacttgtgttcatcatgaaagcggcagcgaaagcactagaagcattc
ccagcgttcaactcttcgctatcagacgacggtgaaagcttgattctgaagaaatacgtg
aacatcggtattgcggtggatacgccaaatggcctagtggttcctgtctttaaagacgtg
aacaagaaaggcatctacgagctatctgaagaactgatggtggtttctaagaaagcacgt
gctggtaagctgactgcagcggacatgcaaggtggctgtttcacgatttcaagcctaggt
ggtatcggtggtactgcgtttacaccaatcgtaaacgcgccagaagtgggtatccttggt
gtgtctaagtctgaaattaagccagtttggaatggtaaagagttcgctcctcgcctacaa
ctgcctctatctctatcatatgatcaccgtgtgattgatggtgcagaaggtgcgcgcttc
attacttacctaaacgagtgcctatctgacattcgtcgtttggttctgtaa

DBGET integrated database retrieval system