KEGG   Vibrio vulnificus CMCP6: VV1_1691Help
Entry
VV1_1691          CDS       T00108                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VV1_1691 (folP)
Enzymes [BR:vvu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VV1_1691 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1674067..1674897
Genome map
AA seq 276 aa AA seqDB search
MILRSQKKSLDLSFPVVMGILNVTPDSFSDGGQFNALDAALAQAERMIAAGVSIIDVGGE
STRPGAPEVSLEEELKRVIPAIQAIRQKHDVWISIDTSKAEVMKQAIEAGADLINDVRAL
KEPGALAVAAKAQVPICLMHMQGQPRSMQHNPSYQDVLKEVSEFLEERVAACEEAGIAKE
LLILDPGFGFGKTIEHNYHLLAHLEAFHQLGLPILAGMSRKSMVFKLLNKKPAECMVASV
TCATIAAMKGAQIIRVHDVEETVEAMRVIQMMHKNI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattctacgttcccaaaaaaaatccttagatctttcattccctgttgtgatgggaatt
cttaatgtcacacctgactcgttttccgatggaggccaatttaatgcgcttgatgcggca
ttggcccaagccgagcgaatgattgctgccggtgtgagtatcattgatgtcggtggtgag
tcaacacgtccaggtgcgccagaagtctcattggaagaagagttgaagcgcgttattcct
gcaattcaagccattcggcaaaagcacgatgtttggatctctattgataccagcaaagcg
gaagtgatgaagcaagccattgaagccggtgcggatctcattaatgatgttcgcgcattg
aaggagccaggggccttggcagttgccgcgaaagcccaagttccgatttgtctgatgcac
atgcaaggccaacctcgaagcatgcagcataacccaagctatcaagatgtattaaaagag
gtcagcgaatttttggaagagcgtgttgcagcctgtgaagaagccggtattgcaaaagag
ctgcttattcttgaccctgggtttggttttggcaaaaccatcgaacacaattatcatctg
ttagcgcatttagaggcatttcatcaattaggtttgccgattttggcgggcatgtctcgt
aaatcgatggtttttaaattactgaacaaaaagcctgcagagtgcatggtggctagtgta
acatgtgcgacgattgctgctatgaaaggcgctcagatcattcgcgttcatgatgtcgaa
gaaaccgttgaagcgatgcgagtcattcaaatgatgcataaaaatatctga

DBGET integrated database retrieval system