KEGG   Vibrio vulnificus CMCP6: VV1_1726Help
Entry
VV1_1726          CDS       T00108                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VV1_1726 (deoA)
Enzymes [BR:vvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VV1_1726 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1713439..1714767
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEALTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMPERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLEAIPGYNITPSNDVFGQVTKEAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLKGEYRNPRLLEVTMASCAEMLVLGKLAENTEDARAKL
MEVLDNGKAAECFGKMVAGLGGPVDFMDNYDNYLDKAEIIKPVYAKETGVVSAMDTRAIG
MAVVAMGGGRRVATDSIDYAVGFDQFIRLGEIASSEKPLAMIHARNEAQWQEAANALQAA
IKVGGEYTPTPDVYRQIRQEDI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttacctcaagaaattattcgtaaaaaacgcgacggcgaagcgctgactgccgac
gaaattaacttttttatccaaggtgtggcgaacaatacggtctctgaaggtcagattgcc
gcgttcgcgatgaccatctttttcaatgaaatgacgatgcctgaacgtattgccctaacg
tgtgcaatgcgagattctggcatggtgattgattggagtcacatgaactttggtggccca
atcgttgataaacactcaaccggcggtgtgggcgatgtgacctctctaatgcttggccct
atggtggcagcatgtggtggtttcgtgccgatgatctcgggtcgtggcctgggccatact
ggcggtacgttagacaaactggaagcgattcctggctacaacatcacaccaagtaacgac
gtattcggtcaagtgaccaaagaagcaggtgtagcgatcatcggccaaacgggcgatctt
gcaccagcagacaaacgagtctatgccactcgtgatattacggcgacggtggacaacatc
tcactgatcaccgcttccattctgtctaagaagttggcggcaggtcttgaatctttagtg
atggatgtgaaagtcggttcgggcgcctttatgccgacttacgaagcttcagaagaattg
gcgaaatccattgtggcggtggcgaatggcgcgggcactaagacgacggcgattttgacc
gacatgaaccaagtattggcttcttctgcgggtaacgctgttgaagttcgtgaagcggtt
cgtttcctcaaaggtgaatatcgtaaccctcgtttgcttgaagtcacgatggcgtcatgt
gctgaaatgttggtacttggtaaattggctgagaataccgaagacgcacgtgcgaaattg
atggaagtactggataacggtaaagcggcagaatgctttggtaagatggtcgcaggttta
ggtggtccggttgactttatggacaactatgacaactacctcgataaagctgaaatcatt
aagcctgtttacgccaaagagaccggtgtggtgtctgcaatggatactcgtgctattggt
atggctgtggtggcgatgggcggtggacgccgcgttgcgacagacagcatcgattacgcg
gtaggttttgatcagtttatccgtttgggcgaaatcgcaagcagcgaaaaaccactggcg
atgattcacgctcgtaacgaagcgcagtggcaagaagccgcgaatgcactacaagcagcg
attaaggtgggtggtgagtacacaccaacaccagacgtatatcgtcaaattcgccaagaa
gatatttaa

DBGET integrated database retrieval system