KEGG   Vibrio vulnificus CMCP6: VV1_1767Help
Entry
VV1_1767          CDS       T00108                                 

Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VV1_1767
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VV1_1767
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VV1_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1755660..1758758)
Genome map
AA seq 1032 aa AA seqDB search
MNNWENFLHLHENRMAPRAYFFSYDTVQQAQTFQRELSSRFMLLSGQWQFHYFSNPMLVP
DEFYSQTMSDWGHITVPNMWQMEGHGDLQYTDEGFPFPIDVPFVPTDNPTGAYQRTFTLG
PQWDDKQTIIKFDGVETYFEVYVNGHYVGFSKGSRLTAEFDISSYAQLGENLLSVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLIGKEPVHVQDLTVRTDFADDYQSATLSAQVELENLST
AIASGYTLEYALHDKGTVVASGQCDSLTIQNRHSASFAIDMVNPTHWTAENPYLYHLFIT
LKDHQGKVVEVIPQRVGFRDIKVRDGLFYINNQYVMLHGVNRHDNDHLKGRAVGMDRVEK
DLMLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVETHGFANVGDLNRITNDPA
WEAVFVDRAVRHVHAQKNHPSIIMWSLGNESGYGCNIRAMYAATKALDDTRLVHYEEDRD
AEVVDVISTMYSRAQLMNYFGEHPHEKPRIICEYAHAMGNGPGGLTEYQNVFYAHAHIQG
HYVWEWCDHGILARDEHGQEFYKYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLKEYKQVI
APVKIRAVEGCYDRFIVENKLWFTNLDDYTITAEVRAEGDTLRSVPFKVEALAANSAREV
SIDLPELDEREAFINFTVRKDSRTLYSEANHDIAVYQFQLKENTATLPALVNHNVQPLVL
EESRLEHVITGHNFTLTFSKVNGKLTSWRVNGEELIQSEPRLNFFKPMIDNHKQEYEGLW
HPAHLQIMQEHFRTLSVDASEDAILITTTSIVAPPVFDFGMRCTYRYQINAQGHLNVELS
GERYGDYPHVIPVIGLDLGINGSFDQVSYYGRGPEENYQDSRQANLIDVYHSTVEDMFEN
YPFPQNNGNRQQVRWASLTNRHGSGLLVKPQQELNFSAWFYTNQNLHQAQHTIELEKSGY
ITLNLDHQVMGLGSNSWGSEVLDSYRVYMDAFRYGLTLMPLQAGDCSAQVMANHDFDNAF
FTSTDTKIVNEA
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaactgggaaaacttcctccatttacatgagaacagaatggcgccgcgtgcgtac
ttcttctcctatgataccgttcaacaagctcaaacctttcagcgtgagttgagcagccgc
tttatgctgttaagtggtcagtggcaatttcattacttcagcaacccaatgctggtgcct
gatgagttttactcacaaaccatgagcgattgggggcacattaccgtacccaacatgtgg
caaatggaaggccacggcgatcttcaatacaccgacgaaggtttcccattcccaattgat
gtgccttttgtacccaccgacaacccaacgggtgcttatcagcgcactttcactttgggt
cctcaatgggacgacaaacaaaccatcatcaagttcgatggcgtggaaacctacttcgag
gtgtacgtcaacggccactatgtcggttttagtaaaggcagccgtcttactgcagagttc
gacatttcttcctacgcacaactaggtgaaaacttactctctgtgcgcgtgatgcaatgg
gccgattcgacttacattgaagaccaagacatgtggtggacggcggggatcttccgtgat
gtttaccttataggcaaagagccggttcacgtccaagatctgactgttcgtactgatttc
gccgacgattaccaaagtgcgacgctcagcgctcaggtcgaattggaaaatctttctacc
gctatcgcgtctggctacacgctggaatacgcgctgcatgacaaaggcactgtcgtagcc
agcggtcaatgcgattcactgacgatacaaaaccgccattcagccagcttcgccattgat
atggtgaacccaacgcattggacggctgaaaacccttacctttaccacttgttcatcacc
ttaaaagatcaccaaggcaaggtcgtggaagtgatcccacaacgcgtgggtttccgtgac
atcaaagtgcgtgacggcctgttctacatcaacaatcaatacgtgatgctgcacggtgtc
aaccgtcatgacaacgaccacctaaaaggtcgtgcagtaggcatggaccgcgtggaaaaa
gatctgatgttgatgaagcaacacaacatcaactcagttcgcaccgcgcactacccgaac
gacccacgcttctacgagctgtgtgatatttacggcctgtttgtgatggcagaaaccgat
gtggaaacccacggctttgccaacgttggcgacctcaatcgcatcaccaacgatccagca
tgggaagcggtgtttgtcgatcgcgcagtgcgccatgtgcatgcacagaaaaaccaccca
tcgatcatcatgtggtcactcggtaacgaatcgggttatggctgtaatatccgcgccatg
tacgccgcaaccaaagcccttgatgacacccgtttggtgcactacgaagaagaccgcgat
gccgaagtggtggatgtgatttccactatgtactcgcgcgcgcaactgatgaactacttt
ggtgagcatccacacgagaagccacgcatcatctgcgaatacgcccacgcgatgggtaac
gggccaggtggtctcaccgaataccaaaatgtgttttacgcgcatgcccacattcaaggc
cactacgtgtgggaatggtgtgatcacggcattctagcgcgtgatgaacacggtcaagag
ttctacaaatacggcggtgattacggcgattacccaaacaactacaacttctgtatggat
ggtctgatttacccagatcaaaccccgggccctggcctgaaagaatataagcaagtgatt
gcgccggtgaaaatccgcgccgttgaggggtgctatgaccgcttcatcgttgaaaacaaa
ctgtggttcaccaacctcgatgactacaccatcactgctgaagttcgcgccgaaggcgac
accttgcgtagcgtgccgtttaaagtcgaagcactggccgcaaacagcgctcgtgaagtg
agcattgacttgccagaattggatgagcgcgaagccttcattaacttcaccgtacgtaaa
gacagccgcaccttgtatagcgaggccaaccacgacattgctgtgtaccagttccaactg
aaagaaaacaccgccacgttgcctgcgttagtcaaccacaatgttcaaccattggtgctt
gaagaaagccgcctagagcacgtgatcacaggtcataacttcacgctcactttctcgaaa
gtaaacggcaaactgacctcatggcgtgtgaatggtgaagagttgattcaatcagagcca
agattgaacttcttcaaaccaatgattgataaccacaaacaagagtacgaagggttgtgg
caccctgcgcatctgcaaatcatgcaagagcacttccgtacgctgagcgtggacgcgagc
gaagatgccatcctgatcaccaccaccagcattgtggcaccacccgtgtttgattttggc
atgcgttgtacctatcgctaccaaatcaacgcgcaaggccatttgaacgtagaactgagt
ggcgagcgctacggcgactaccctcacgtgattccggtgattggtttggatttaggcatt
aacggtagctttgatcaagtgagttactacggtcgcggcccagaagagaactatcaagac
agccgccaagccaacctcattgatgtttaccacagcaccgtcgaggacatgttcgagaac
tacccgttcccacaaaacaacggcaaccgccaacaggtgcgctgggcctcactcaccaac
cgtcatggcagtggtttgttggtcaagcctcagcaagagcttaacttcagtgcgtggttc
tacaccaaccaaaacctgcatcaagcacaacatacgattgagctagaaaagagtggctac
atcacgcttaaccttgaccatcaagtaatgggcttgggttcaaactcttggggcagtgaa
gtgctcgactcttaccgcgtgtatatggatgcattccgctacggcctcactctgatgcca
ttgcaagcaggcgattgcagcgcgcaagtcatggcaaaccatgatttcgacaacgcattt
ttcacttcaaccgataccaaaatcgttaacgaggcgtaa

DBGET integrated database retrieval system