KEGG   Vibrio vulnificus CMCP6: VV1_1797Help
Entry
VV1_1797          CDS       T00108                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VV1_1797 (recD)
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VV1_1797 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1794510..1796624
Genome map
AA seq 704 aa AA seqDB search
MMLNGSLQATLSMLEQQAQQGYLRLLDYQFARFIGEQSQHSGLALLAAAVSAELGKGHIC
LPLFDELGQVCELASKIGLFGEAATELNAQLQSFDWRALLQTSRLVGTQGEAVPLMFDGE
RVYLHRYWHYEVVLAQKLNQLSHGIELNASSAASLSALLDRLFARDYRFLFETLIAAQAS
GSTQVQRQQWVCDFLDVVEEHRLDWTAIEQVLSQVSKVSDLNALDHLVPHAACINWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQAGAQTPTIRLVAPTGKAAARLTESIG
KAVQSLAVEPSLKALIPTEASTLHRLLGAIPGSAEFRHHSQNPLHLDVLVVDEASMVDLS
MMYKVIDALPKHARLILLGDKDQLASVEAGAVLGDICAFSASGYSAEQAATLAKLTGYQA
LPKSASRLAPVADSLCMLQKSYRFDARSGIGQLAKAINAGSVAALESVWQREFNDIEHHP
LDASHYNHMLQTLVSEYSHYLARIALTQQHLEPKERESSAVRAKAGLNLFHRCRLLCAVR
EGNFGVAGLNLRIERALAARNLIKVKDEIWYHGRPVMVTRNDYALGLYNGDIGICMWDDT
DEAPRLKVYFELADGSVKAVLPSRVPEHETAYAMTIHKSQGSEFDFTLMILPADFSPILT
RELIYTGITRAKKRLALYADLQVLKRGMKIKTQRASGLPHRLGQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgaatgggtcactccaagcgacgctgtcgatgctggaacagcaagcccaacaa
ggctacctgcgcttattggattatcaatttgcgcgctttattggtgagcagagtcagcac
agcggattggcgctgttggccgctgcggtcagtgccgagttaggcaaagggcatatttgc
ttgcctctgtttgatgaacttggccaagtctgtgaattggccagcaaaattggcctgttt
ggtgaggcggcaaccgagctgaacgcccagttgcagtcgttcgactggcgagcattgctg
caaaccagtcgcttggttggcacccaaggggaagcggtgcccttgatgttcgatggggaa
cgagtttatctgcatcgctattggcactatgaagtcgttttggcgcaaaaacttaatcaa
ttgagtcacggtattgaacttaacgccagctcagcggcatcgttatccgcattgctggat
cgattgttcgcgcgagattaccgctttttgttcgaaacgctgattgccgcgcaagcgagc
ggcagtacccaggtgcagcgacagcaatgggtgtgtgattttctcgacgtggttgaagag
caccgtttggattggacggcgattgaacaagtgctgagccaagtaagcaaagtctcagat
ctcaacgcgctggatcatcttgtgcctcatgcggcctgcattaattggcaaaaggtagct
gccgcggtggcgttgacgcgtcgttttgccgtgatctctggggggccgggaacaggcaaa
accaccaccgtcacgaaattgttggcggcgctgattgagcaagctggagcgcaaacgccc
accattcgtttggtggcgccaacgggtaaagcggcggcgcgtttgaccgaatccatcggt
aaagcggtgcaatctttagccgtagagccgagtttaaaggcgttaatccccacagaagcc
tcaacattacatcgcttgttaggcgcgatccccggcagtgccgagtttcgtcatcacagt
caaaacccgctgcatttggatgtgctggtggtggatgaagcctcaatggtcgatctttcg
atgatgtataaagtgattgacgcgctgcctaaacatgctcgtttgattttactcggtgat
aaagatcagttggcctccgttgaagcgggggcggtgctgggggatatctgcgcattttct
gcttccggatacagcgcagagcaagcagcaacgctcgcgaagttaacgggttatcaagcg
ctgccaaagagtgccagccgtttggcaccagttgcagatagcttgtgtatgttgcaaaag
agctatcgttttgatgctcgctcaggaattggccaattggcaaaagcgatcaatgccggt
tccgtggcggcgttagagagtgtatggcagcgagagtttaacgatatcgaacatcaccca
ttggatgccagccactacaaccatatgttgcaaacgcttgtaagtgagtactcacattat
cttgctcgcattgccttaactcagcagcatcttgagccgaaagagagagaaagcagtgct
gttcgagccaaagcgggactgaatttgtttcatcgttgccggttactttgcgccgtgcgt
gaaggcaattttggtgtggccggacttaaccttcgcattgaaagagccttagctgcgcgg
aatttgattaaagtgaaggacgagatttggtatcacggcaggcctgtaatggtgacgcgt
aatgattacgcgcttgggctttacaacggcgacattggcatctgcatgtgggatgacact
gacgaagccccgcgtctaaaagtctattttgagttggctgacggcagcgttaaagcggta
ttaccaagccgagtgccagaacatgaaacagcctatgcgatgacaatacataaatcacaa
ggcagcgaatttgattttaccttgatgattttgcctgccgatttcagcccaatactgacg
cgagagctgatctacacgggcattactcgagcgaaaaagcgtttagcgctgtatgccgat
ctccaagtcctgaaacgtggtatgaagataaaaacacagcgagcgagcggcctgccacac
cgtttgggccagtaa

DBGET integrated database retrieval system