KEGG   Vibrio vulnificus CMCP6: VV1_2005Help
Entry
VV1_2005          CDS       T00108                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VV1_2005 (recR)
DNA repair and recombination proteins [BR:vvu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VV1_2005 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2001384..2001986
Genome map
AA seq 200 aa AA seqDB search
MRTSHMLEQLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLADALSHAMTEIGHCNEC
RTFTEEDVCHICNNPKRQENGLLCVVESPADIAAVEATGQFSGRYFVLMGHLSPLDGIGP
SDIGLDVLDYRLRRGDIKEVILATNPTVEGEATAHYIAELCREHKVDASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKLN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagccatatgctggaacaattgatggaggccttacgttgtttgcctggggtt
ggccccaagtcagcacagcgtatggcctttcatttgttacagcgagatagaaaaggcggc
ctgcagcttgcggatgcattaagtcatgccatgacggaaattggtcactgtaacgagtgc
cgtacttttaccgaagaagacgtttgtcatatctgcaacaacccaaaacgccaagaaaac
ggattattgtgtgtggtcgaaagccctgccgatatcgctgcggtggaagccacaggacaa
ttctctggtcgttactttgtgttgatggggcacctatcaccgcttgatggtattggacct
agtgatattggcctcgatgtcctcgattatcgtctgcgtcgcggtgatatcaaagaagtg
atcttagcgaccaaccctaccgtggaaggtgaagcgactgcgcactacatcgctgaactt
tgtcgagagcataaagtggacgccagtcgaattgctcatggtgtgcccgtcggtggggag
cttgagctggtggatggcactacgctctcccattcgttattgggcagacacaaactcaac
taa

DBGET integrated database retrieval system