KEGG   Vibrio vulnificus CMCP6: VV1_2919Help
Entry
VV1_2919          CDS       T00108                                 

Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VV1_2919
  Amino acid metabolism
   00340 Histidine metabolism
    VV1_2919
Enzymes [BR:vvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     VV1_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2984883..2986178)
Genome map
AA seq 431 aa AA seqDB search
MRTVVWQSLSETQQDAILERPAITEGANITAAVAEVIAKVRAEGDAALFELTEKFDRVKP
ESIRVTEQEIEEASARLTAKMKQALEQAYANIAKFHNAQKPTPIKVETQPGVVCEQVTRP
IQKVGLYIPGGSAPLPSTVLMLGVPAQIAGCRKVVLCSPPPIADEILYVAKLCNIDEVYN
VGGGQAVAAMAYGTESVTKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DETADADFIAADLLSQAEHGPDSQVVLVTPSVLIADQVTDAVQKQLKQLSRASIAEKALA
SSLIIIADSLTQAVSISNYYGPEHLIVQTKNPRELLPLLDNAGSIFLGDWSPESAGDYAS
GTNHVLPTYGYTRTYSSLGLADFSKRMTIQELSAEGLKTLAPTVVTMAEAEGLDAHKRAV
TIRVEKLNARG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagaacggttgtttggcaatctcttagtgagacgcaacaagacgctattttggaacgt
ccagcgataacagaaggtgcgaatattaccgctgcagtagcagaagtgattgcgaaagtc
agagcagaaggcgatgcggcgctgttcgaactgacggaaaagtttgatcgcgttaaacca
gaatcgattcgagtgactgaacaagaaatcgaggaggcttctgctcgcttaactgcaaaa
atgaagcaagcgcttgagcaggcttacgccaatatcgcgaagttccacaatgcccagaaa
ccgacgccaattaaagtcgaaacacaaccgggtgtggtgtgtgaacaagtcactcgcccg
atacaaaaagtgggtttatacattcctggtggcagtgcaccgctgccttcaacggtattg
atgttgggtgttcctgcgcaaatcgcgggttgccgtaaagtggttttatgttcaccgcca
ccgattgccgatgaaattctctatgtggcaaagctttgtaatatagatgaagtttacaat
gtcggtggtgggcaagcggtagcggcgatggcttatgggacagaaagtgtcactaaggtg
gataaaatatttggtcctggcaacgcgtatgtcacagaagcaaaacgccaagtgagcaat
gattttcgtggtgccgctattgatatgcccgctgggccatcagaagtgttggtgattgct
gatgaaactgcagatgccgattttatcgccgccgatttacttagccaagctgagcacgga
ccagactctcaagtggttttggtgactccatcagtattgattgcagatcaagtaacggat
gctgtgcagaaacagttgaagcaattatcgcgtgcctcaattgctgaaaaagcactagcg
tcgagcttgattattattgctgactccttgacccaagcggtttctatttcaaattattac
ggtccagagcatttaattgttcaaaccaaaaatcctcgagagttgttgccattgctggat
aacgcaggttccattttcttgggtgattggtcgcctgaatcggcgggtgattatgcgtca
ggaaccaaccacgtattgccgacgtatgggtacacccgtacgtattcaagtttaggtttg
gctgatttttcaaaacgtatgacgattcaagaactatcggctgaaggtttaaaaacactg
gcacctacggttgttacaatggcagaagcggaagggttggatgcgcacaaacgtgcggtg
accattcgtgtcgaaaagctgaatgcacgtggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system