KEGG   Vibrio vulnificus CMCP6: VV1_3067Help
Entry
VV1_3067          CDS       T00108                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01130  Biosynthesis of antibiotics
vvu01230  Biosynthesis of amino acids
Module
vvu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VV1_3067
Enzymes [BR:vvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VV1_3067
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VV1_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: AAO11391
Position
I:3138317..3139747
Genome map
AA seq 476 aa AA seqDB search
MMTNSNEKLSEHVSLQEAQMAEVLAKIVRDKYQWVAERKHAQPLASFQATLTPSDRSFYQ
ALRGQRTVFITECKKASPSKGLIREDFDLDYIASVYNHHADAISVLTDEKYFQGSFDFLP
RVRQQVRQPVLCKDFMVDSYQVYLARHYQADAILLMLSVLNDEQYQTLADVAHQLQMGVL
TEISNDEELERAVKLGAKVIGINNRNLRDLTTDLNRTKVLAPTLRRLAPEAIVISESGIY
THQQVRDLAQYADGFLIGSSLMAEKNLELAVRKVTLGENKVCGLTHPEEAAKAYQAGAVF
GGLIFVEQSKRAVNIEQARLTMSGAPLNYVGVFQNHPVTLVAETANQLQLHAVQLHGNEE
ADYIAQLRKQLNESIEIWKAYGVTDQAPTLLTQDVDRHLFDAQVGQQSGGTGTTFDWALL
DDPSHIMLAGGLNPDNAQKAASLGCLGLDLNSGVEESPGKKDLTKLQQAFAAIRNY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaacagcaacgaaaaactgtcagaacacgtttctctgcaggaagcacaaatg
gcggaagtcctagccaagatagttcgcgataaataccagtgggtagccgagcgtaaacac
gcgcaaccattggccagttttcaagccacattgacaccatcggatcgcagcttttaccaa
gccttgcggggccaacgcacggtattcattaccgaatgtaagaaagcctccccatcaaag
ggattgatccgtgaagatttcgacttggattacatcgcgtcggtgtacaaccaccacgca
gatgcgatttcggtactcaccgatgagaaatacttccaaggcagcttcgactttctgccc
cgagtgcgtcagcaagtgcgccagcctgtgttgtgtaaagattttatggtcgatagctat
caagtttatctcgctcgtcactatcaagccgacgccattttattgatgttgtcagtcctc
aatgacgagcaatatcaaacactggcagatgttgcccaccagttgcaaatgggtgtgctg
acagaaatcagtaatgacgaagagcttgagcgtgctgtgaagctgggggcgaaggtgatt
ggcattaacaaccgcaacttacgtgacctcaccaccgatttgaatcgcaccaaagtactc
gcgccaactttgcgtcgcctagcaccagaagcgattgtgatctcggaatcgggcatttac
acccaccagcaagtgcgcgatctcgcccaatacgctgatggctttttgatcggtagctca
ctgatggcagaaaaaaacctcgagctcgcggtacgtaaagtgacactgggtgaaaacaaa
gtctgtggtctcactcatccggaggaagccgccaaagcctatcaagctggcgctgtcttt
ggtggtttgatttttgtagagcaatccaaacgtgctgtaaatatagagcaggcaagactg
acgatgagtggcgctccgctcaattatgttggcgtgttccaaaatcaccccgttaccttg
gtggccgaaaccgcaaaccagctgcaactgcatgcggtgcaattacatggcaacgaagaa
gccgattacatcgcacaactgcgcaagcaactcaacgaatcgattgagatttggaaagcc
tatggcgtgaccgaccaagcaccgactctacttactcaagatgttgatcgtcatcttttc
gatgcgcaagtcggccaacaaagcggtggaacagggactacgtttgattgggctttattg
gatgatccaagccatatcatgttggctggcggtctcaatccagacaatgcacaaaaggca
gcaagccttggatgtttaggactggatttaaactctggtgttgaagaaagccctgggaaa
aaagatctgacgaagctgcagcaagcgtttgcagccatccgaaattattga

DBGET integrated database retrieval system