KEGG   Vibrio vulnificus CMCP6: VV1_3068Help
Entry
VV1_3068          CDS       T00108                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VV1_3068 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VV1_3068 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VV1_3068 (trpB)
Enzymes [BR:vvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VV1_3068 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:3139823..3141013
Genome map
AA seq 396 aa AA seqDB search
MTKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPDFRSEFMGLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGATVIPVHSGSATLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEETVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDENGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDSITDDEALDAFQELARSEGIIPALESSHALAHALKM
ARNNPEKEQLLVVNLSGRGDKDIFTVHAILEEKGAI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactaagttaaatgcctactttggcgaatacggcggtcagtacgtacctcagattctg
gtacccgcattagagcagctcgagcaagcgttcattgacgcccaagaagacccagatttc
cgcagtgagtttatggggttactccaagaatacgcaggccgcccaaccgcactgacgctg
acgcgcaatctaaccaaaggcaccaaaaccaaactgtacctaaaacgtgaagatttactg
cacggtggcgcgcacaaaaccaaccaagtacttggtcaagcactgttggctaaacgcatg
ggcaaaaacgaaatcattgctgaaacgggcgcaggccaacatggcgttgccactgcactt
gcctgcgcactactgggcttgaagtgtcgcgtgtacatgggagcaaaagacgtcgagcgc
caaagtcctaacgtgtttcgtatgaagttaatgggcgcgacggtgattccggtgcactca
ggttccgccacactgaaagacgcatgtaatgaagcattgcgtgattggtctggtagctat
gaaaccgcccactacttattgggcactgccgcgggtccccaccctttcccaaccatcgta
cgtgagttccaacgtatgattggtgaagaaacgaagaatcagatcctcgcacgtgaagga
cgcctgcctgatgcagtgattgcttgtgtgggtggcggctcaaacgccatcggtatgttc
gccgactttatcgaagaagaaacggttcgcctgattggtgttgaacctgcgggcaaaggc
attgataccgaccaacatggcgcgcccttaaaacatggcaaaactggcattttctttggt
atgaaagcgccactcatgcaagatgaaaacggccaagtcgaagagtcatactccgtttcc
gcaggtctcgatttcccatcagtgggtcctcaacacgctcaccttaatgccattggtcgc
gctgaatacgacagcatcaccgatgatgaagcgcttgatgcgttccaagagttggcaaga
agtgagggtattattcctgcgttagaatcgtctcacgctttggcacatgcgctgaaaatg
gcccgcaacaacccagagaaagagcagttgttggtcgttaacctatctggtcgaggtgac
aaagacatctttaccgttcatgccattttagaagaaaaaggagcaatctaa

DBGET integrated database retrieval system