KEGG   Vibrio vulnificus CMCP6: VV1_3069Help
Entry
VV1_3069          CDS       T00108                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00260  Glycine, serine and threonine metabolism
vvu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01130  Biosynthesis of antibiotics
vvu01230  Biosynthesis of amino acids
Module
vvu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VV1_3069 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VV1_3069 (trpA)
Enzymes [BR:vvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VV1_3069 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAO11393
UniProt: Q8D8B1
Position
I:3141013..3141819
Genome map
AA seq 268 aa AA seqDB search
MDRYQATFERLAAQKQGAFVPFVTVCDPNPELSLKIMDTLVKAGADALELGIPFSDPLAD
GPTIQGANIRALDSGATPDICFDLIGQIRAKYPDLPIGLLMYANLVYSRGIENFYQRCAQ
AGIDSVLIADVPTNESAEFVAAAEKFGVHPIFIAPPTASDETLKQVSQLGGGYTYLLSRA
GVTGAETKANMPVGDMLAKLEQFNAPPALLGFGISEPEQVKQAIDAGAAGAISGSAVVKI
IESHLNEPDAMLTALANFVSNMKSATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttatcaagcgacatttgagcgcctcgccgcgcaaaaacaaggtgcctttgtt
ccttttgttaccgtgtgtgaccctaaccctgaactctcactcaagatcatggatacctta
gttaaagcgggtgccgatgctcttgaacttggcattccattttctgatccattggccgac
ggcccaacgatccaaggcgcaaatattcgcgcgctggattcaggcgcaacacctgatatc
tgttttgatttgatcggacaaatccgagctaaatacccagatctaccgattggcctgttg
atgtacgcaaacttggtctattcacgtggtatcgagaatttctaccaacgttgcgctcaa
gcaggcattgattctgtgttgatcgccgatgtcccaacgaacgaaagtgcagagtttgtc
gcggcagccgaaaagtttggtgtacatccaatctttatcgcaccaccaacggccagtgat
gaaacactaaaacaggtttcacaactgggtggcggttatacctatcttctctctcgagcg
ggggtcacaggagctgaaacaaaagccaacatgcctgtgggtgatatgcttgcgaagcta
gaacaatttaatgcgccacctgcactgttgggctttggtatatcagagcctgaacaagtc
aaacaggctatcgatgcgggtgcggcaggtgccatttcaggctctgcagtggtcaaaatc
atcgaaagtcacctcaatgaacctgacgcgatgttaacggcactggcaaactttgtttcc
aacatgaagtctgcaacacaaaagtaa

DBGET integrated database retrieval system