KEGG   Vibrio vulnificus CMCP6: VV1_3111Help
Entry
VV1_3111          CDS       T00108                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VV1_3111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1_3111
   00620 Pyruvate metabolism
    VV1_3111
   00650 Butanoate metabolism
    VV1_3111
  Lipid metabolism
   00071 Fatty acid degradation
    VV1_3111
  Amino acid metabolism
   00350 Tyrosine metabolism
    VV1_3111
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VV1_3111
   00626 Naphthalene degradation
    VV1_3111
Enzymes [BR:vvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VV1_3111
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VV1_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3177111..3179786)
Genome map
AA seq 891 aa AA seqDB search
MPVTNMAELDAMIARVKKAQEEFATYSQEQVDAIFRAASLAANQARIPLAQMAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLEAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVDAVYDEVKERFASHKAYVLSKAEAEKVRKVLLIDGALNAKIVGQP
AAAIAEMAGVKVPADTKVLVGEGLGKVSYDDAFAHEKLSPTLGLFRADDFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKLKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALSDLEGKKR
AFLVTDRFLFNNGYADDVVQLLKAQGMEVQTFFDVEADPTLSVVEKGAAAMQSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYELTPQMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGAKDPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLAWLDELKGNLDIPMSIQAAGVAEADFLAKVDELAVEAFDDQC
TGANPRYPLIAELKEVLLASYYGKAFVEGETFEGTTVIKKKADQVAPKAKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaatatggctgaactagatgcgatgattgcacgcgttaagaaagcgcaa
gaagagttcgctacttactctcaagagcaagtagatgcaatcttccgtgcagcttctcta
gccgctaaccaagctcgtatcccgctagcacaaatggcggttgaagaatctggtatgggt
attgttgaagataaagtaatcaagaaccactttgcatctgagtttatctacaacaaatac
aaggacgaaaaaacgtgtggcatcctagaagaggatgacaacctaggtacgatgactatc
gctgaaccagtaggtatcatctgcggtatcgttccaaccactaacccaacttcgactgca
atcttcaaatcactgatctctttgaagactcgtaacggtatcatcttctcgccacaccca
cgtgcgaaaaactcgactaacgacgcagcgaaactggttctagaagcagcggtagcagct
ggcgcaccaaaagacatcatcggttggatcgaccagccatctgtagagctttctaacgcg
cttatgaagcacgatgacatcgcacttatccttgcaactggtggtccaggcatggttaaa
gctgcttactcttctggtaagccagcaatcggtgtaggtgcaggtaacgttcctgttgtt
atcgatgaaactgcggacatcaaacgtgcagttgcatctatcctaatgtctaagacgttc
gataacggcgtagtatgtgcttctgagcaagctgcaatcgttgttgacgcagtatacgac
gaagtgaaagagcgttttgcttctcacaaagcatacgtacttagcaaagctgaagcagaa
aaagtacgtaaagtactgctaatcgatggcgcactaaatgcgaaaatcgttggccagcca
gctgcagcaatcgctgaaatggcaggtgttaaagttcctgctgatactaaagttctcgtt
ggtgaaggcctaggcaaagtgtcttacgatgacgcatttgctcacgagaagctatctcca
actctaggtctattccgtgctgatgacttcgaagacgcagttgcacaagcagtaaccatg
gttgaaatcggcggtatcggtcacacatctggtctatacactaaccaagacgtaaacgca
gaccgtatccgttacttcggtgacaaactgaagactgcacgtatccttgtaaacatccca
actactcacggtggtatcggtgacctttacaactttaacgttgcaccatctctaactctt
ggttgtggttcatggggtggtaactctatctctgagaacgtaggtcctaagcacctaatc
aacaagaaaactgttgcgaagcgagctgaaaacatgttgtggcacaaactacctaagtca
atctacttccgtcgtggtagccttccaatcgcactaagcgacctagaaggtaagaaacgc
gcattcctagtaactgaccgtttcctattcaacaacggttacgcagatgacgtagtacaa
cttcttaaagctcaaggcatggaagttcaaacattctttgatgttgaagctgacccaacg
ctatctgttgtagagaaaggcgcagcggcaatgcaaagcttccagccagatgtgattcta
gcgctaggcggtggttcaccaatggatgctgcgaagatcatgtgggtaatgtacgagcac
ccagaaactcacttcgaagaacttgcaatgcgctttatggatatccgtaaacgtatctac
aagttccctaaaatgggtaagaaagctgaacttgtatgtatcactaccacttcaggtaca
ggttcagaagttacaccattcgcggttgtgactgacgacaagactggtgctaagtaccca
ctagcggattacgaattgactcctcaaatggcaatcgtagatgcgaacctagtgatgaac
atgcctaagtctctaaccgcattcggtggttacgatgcagtgactcacgctctagaagct
tacgtatctgttcttgcgaacgaatactcagatggtcaggctctacaagcacttaagatg
ctaaaagagtacctaccttcaagctacgcgaacggtgcaaaagacccaatcgctcgtgag
aaagtacacaacgcagcgaccatcgctggtatcgcattcgcgaacgcgttcttaggtgta
tgtcactctatggcgcacaagatcggtgcagagttccacctaccacacggtttggcgaac
gctctacttatctctaacgtggtacgttacaacgcgaacgataacccaactaagcaaact
gcgttctctcaatacgaccgtccacaagcacgtcgtcgttacgctgaagttgctgaccac
ctaggcctaagccaagctggtgaccgcactgctcagaagattgaacgtctactagcatgg
ttggatgagctaaaaggtaacctagacatcccaatgtctatccaagcggcaggtgttgct
gaagctgacttcctagcgaaagttgatgaactagcagtagaagcgttcgatgaccagtgt
actggtgcgaacccacgctacccactaatcgctgagctaaaagaagttctactggcttct
tactacggtaaagctttcgttgaaggtgaaactttcgaaggtacgactgtaatcaagaag
aaagcagaccaagtagcgccaaaagcgaaaaaataa

DBGET integrated database retrieval system