KEGG   Vibrio vulnificus CMCP6: VV1_3141Help
Entry
VV1_3141          CDS       T00108                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1_3141
Enzymes [BR:vvu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VV1_3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3212112..3212996
Genome map
AA seq 294 aa AA seqDB search
MDLNSLPALTVLSDCVTIVEKDNVKIVRVIHEKATAGISLFGGHVVSYQPTGTADVIWMS
DKAVFDGKTALRGGIPVCWPWFGRIAAPAHGFARTSEWELVEHRENDNGVIVELALFPTE
ESHNLWPHMFDVRLIVEIGDELKVSLNILNIDDDAFTFSGALHTYLNVGDIEQTQTMGMG
SEYIDSLKAGELCNGGEVLQLTDTIDRVYTQPEKEIVVKDPVIERTLCIENQGHNSAVLW
NPWAQGAAGMADMSDDGYKTMLCVESTLHADSITQGKTLNPGESHQLITVLSAR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaattcacttccggcgctgactgtcctgtctgattgcgtcaccattgttgaa
aaagacaatgtcaaaattgttcgtgtgattcacgagaaagcaaccgcaggtatctctttg
tttggcggccatgttgtctcctatcagccgacgggtacagctgacgtcatttggatgagt
gacaaggcagtatttgatggaaaaactgcgctgcgcggcggcattccggtttgttggcct
tggtttggccgcattgcagcacctgcacacggctttgctcgcacttcagagtgggaactg
gttgaacaccgcgaaaacgacaacggtgtgatcgtggaactcgccttgttcccgacagaa
gaatcgcacaatctctggcctcatatgtttgatgttcgcctaatcgtcgagatcggcgat
gaactgaaagtgtcactcaacattcttaatattgatgacgacgcattcactttctcgggc
gctctgcatacctatttgaacgtcggtgatattgaacaaactcaaactatgggcatgggc
tctgagtacattgacagtttgaaagcgggcgaactatgcaatggcggtgaagttttacaa
ttgaccgacacgatcgatcgcgtctacacgcaacctgagaaagagattgtggttaaagac
ccagtcattgaacgtactctgtgcattgaaaaccaaggtcacaacagcgccgtgctctgg
aacccttgggctcaaggtgccgctggcatggcggacatgagcgatgacggttacaaaacc
atgctgtgtgtagaatccactctgcatgcagacagtattactcagggcaaaacgctcaac
cctggcgaaagtcaccagttaatcactgtgctttctgcgcgctaa

DBGET integrated database retrieval system