KEGG   Vibrio vulnificus CMCP6: VV2_0069Help
Entry
VV2_0069          CDS       T00108                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vvu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vvu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(68861..69997)
Genome map
AA seq 378 aa AA seqDB search
MRSILQQQKPPFIWLNIVIFVTSLVLALVVTPWYGIKEGFGFEHLIWLLVTFSFTNLSIT
AGYHRLWSHKTYEAHPLLRVVFAIGGAFSLQNSALHWSSDHRMHHKFVDHHDKDPYSASR
GFWFSHIGWMLRDYNQSTYNDYTNCRDLQKDPVIMWQHKYYVPLAIATNLGIPLLLGWYY
QDIIGMLLVVGALRLTLSHHSTFFINSLAHIWGKQTFTDKNSARDNGFLAVLTFGEGYHN
FHHIFENDYRNGIYWWQYDPTKWLIKSCSWLGLTRNLRLTPQMKIDKARAATRLKNALHQ
LAQRGEQESLKQQLQLEFDGLVATMKDYYDAKKQLLECKKQTAFKKYEVALVKIRYQQAK
EDLLSRYKRWHALTAHYA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtctatcttgcaacaacagaaaccgccattcatatggctcaacattgtcatcttt
gttacgtcattagtactcgcccttgtggtcacaccttggtacggtatcaaggaagggttt
ggttttgagcacctcatctggttactcgtcacttttagcttcaccaacctttccattact
gctggctaccatcgtttgtggagccataagacttatgaagcgcatcctttgctccgtgtt
gtctttgccatcggcggtgctttctctctacaaaacagcgcattgcattggtcttcagat
catcgtatgcaccacaagtttgttgatcaccacgataaagatccctactctgcgagccgc
ggcttctggttttctcatattggctggatgctgcgagactacaatcaatcaacctacaac
gattacactaactgtcgcgacctccaaaaagatcccgtcattatgtggcaacataagtac
tatgtgccgctggcaatagcgacaaacttgggcatccctttgttattgggttggtattat
caggacatcatcggcatgctacttgtggtcggcgcactacgtttaacgctgagtcatcat
tcgacgttctttattaattccttagcccatatttggggaaagcagacctttaccgacaaa
aacagtgcaagagacaatgggttcttagccgttttaacctttggtgagggataccataat
tttcaccatatctttgaaaacgactaccgcaacgggatttattggtggcagtacgaccca
acaaaatggttgatcaaaagctgttcatggttaggtctaacccgcaacttgcgcctcact
ccacaaatgaaaatcgacaaagccagagctgccacacggctgaaaaatgcgctccaccag
cttgcgcagcgtggtgaacaagagtcactcaaacaacaattgcaattggaattcgatggc
ctagttgccacgatgaaagattactacgatgcaaagaaacagcttctagagtgtaaaaaa
cagactgcttttaagaaatatgaggtggcgttagtaaaaatacgttatcaacaagccaaa
gaagacttgttaagccgttataaacgctggcacgcgctcactgcgcattatgcttag

DBGET integrated database retrieval system