KEGG   Vibrio vulnificus CMCP6: VV2_0069Help
Entry
VV2_0069          CDS       T00108                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VV2_0069
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VV2_0069
Enzymes [BR:vvu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VV2_0069
Lipid biosynthesis proteins [BR:vvu01004]
 Desaturase
  First
   VV2_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(68861..69997)
Genome map
AA seq 378 aa AA seqDB search
MRSILQQQKPPFIWLNIVIFVTSLVLALVVTPWYGIKEGFGFEHLIWLLVTFSFTNLSIT
AGYHRLWSHKTYEAHPLLRVVFAIGGAFSLQNSALHWSSDHRMHHKFVDHHDKDPYSASR
GFWFSHIGWMLRDYNQSTYNDYTNCRDLQKDPVIMWQHKYYVPLAIATNLGIPLLLGWYY
QDIIGMLLVVGALRLTLSHHSTFFINSLAHIWGKQTFTDKNSARDNGFLAVLTFGEGYHN
FHHIFENDYRNGIYWWQYDPTKWLIKSCSWLGLTRNLRLTPQMKIDKARAATRLKNALHQ
LAQRGEQESLKQQLQLEFDGLVATMKDYYDAKKQLLECKKQTAFKKYEVALVKIRYQQAK
EDLLSRYKRWHALTAHYA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtctatcttgcaacaacagaaaccgccattcatatggctcaacattgtcatcttt
gttacgtcattagtactcgcccttgtggtcacaccttggtacggtatcaaggaagggttt
ggttttgagcacctcatctggttactcgtcacttttagcttcaccaacctttccattact
gctggctaccatcgtttgtggagccataagacttatgaagcgcatcctttgctccgtgtt
gtctttgccatcggcggtgctttctctctacaaaacagcgcattgcattggtcttcagat
catcgtatgcaccacaagtttgttgatcaccacgataaagatccctactctgcgagccgc
ggcttctggttttctcatattggctggatgctgcgagactacaatcaatcaacctacaac
gattacactaactgtcgcgacctccaaaaagatcccgtcattatgtggcaacataagtac
tatgtgccgctggcaatagcgacaaacttgggcatccctttgttattgggttggtattat
caggacatcatcggcatgctacttgtggtcggcgcactacgtttaacgctgagtcatcat
tcgacgttctttattaattccttagcccatatttggggaaagcagacctttaccgacaaa
aacagtgcaagagacaatgggttcttagccgttttaacctttggtgagggataccataat
tttcaccatatctttgaaaacgactaccgcaacgggatttattggtggcagtacgaccca
acaaaatggttgatcaaaagctgttcatggttaggtctaacccgcaacttgcgcctcact
ccacaaatgaaaatcgacaaagccagagctgccacacggctgaaaaatgcgctccaccag
cttgcgcagcgtggtgaacaagagtcactcaaacaacaattgcaattggaattcgatggc
ctagttgccacgatgaaagattactacgatgcaaagaaacagcttctagagtgtaaaaaa
cagactgcttttaagaaatatgaggtggcgttagtaaaaatacgttatcaacaagccaaa
gaagacttgttaagccgttataaacgctggcacgcgctcactgcgcattatgcttag

DBGET integrated database retrieval system