KEGG   Vibrio vulnificus CMCP6: VV2_0266Help
Entry
VV2_0266          CDS       T00108                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VV2_0266
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VV2_0266
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VV2_0266
Lipid biosynthesis proteins [BR:vvu01004]
 Fatty acid synthase
  Component type
   VV2_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(293827..294429)
Genome map
AA seq 200 aa AA seqDB search
MVRLFSLLIMFFLSSVAHATEKVLIVGDSLSAGYNMSAEQAWPNLLPEALNTYGKNVEVI
NASISGDTTGNGLSRLPELLKTHSPDWVLIELGANDGLRGFPHKVISSNLSRMIQLSKAS
DAKVALMQIRVPPNYGKRYTDAFVELYPTLAEHHQVPLLPFFLEQVIVKPEWMMPDGLHP
MPEAQPWIAQFVAKTFYKHL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggtcagattgttttccttacttataatgtttttcctttctagcgtcgcacacgcaacc
gagaaagtgttaattgttggcgacagcctaagtgcaggatacaacatgtctgcagagcag
gcttggccaaatttgttaccagaagcattgaatacatacggaaaaaacgtagaagtgatc
aacgccagtatctctggagacacaaccggcaatggactatctcgtctgcctgagttgtta
aaaacgcactcaccagactgggtgcttattgagctgggggccaatgatggcttgcgaggt
tttccacataaagtgatctcttcaaacctttcgcgaatgattcaattaagcaaagcctca
gacgctaaagtcgcactgatgcaaattcgtgtcccacctaactatggcaagcgctacacg
gatgcatttgttgaactctatcctacgcttgccgaacatcatcaagtgccactcctgccg
tttttcttagaacaagtgatcgtcaaaccggagtggatgatgcctgatggcttacatcca
atgcccgaagctcagccttggatcgctcaatttgttgcaaaaacgttttacaaacatctc
tga

DBGET integrated database retrieval system