KEGG   Vibrio vulnificus CMCP6: VV2_0378Help
Entry
VV2_0378          CDS       T00108                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VV2_0378
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VV2_0378
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VV2_0378
Two-component system [BR:vvu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   VV2_0378
Bacterial motility proteins [BR:vvu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VV2_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:398658..399239
Genome map
AA seq 193 aa AA seqDB search
MDCCRHKYEAVVIGASAGGLAAVATVLQQLKDSFCIPILLVQHISASPESYIAAHFDSKS
HLSVHEAEDKQPIKNGNMYIAPPNYHMMIETDGCIALSVDPPVNFSRPSIDVLFETAADY
YRNALIGIVLTGANSDGALGLKKIKTLGGLTLVQSIDSAEAKAMPAAAMAAVDVDHILSL
EEIGHYLNTLCDC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggattgttgtaggcacaaatatgaagcagtggtaatcggggcatccgctggaggattg
gccgccgttgcaacggtattacagcaacttaaggattcattttgtatccctattttgttg
gttcagcatatcagtgcctctcctgagagttacattgccgcccattttgatagcaagagc
catttgtcggtccatgaggcagaagacaagcagccaatcaaaaacggcaacatgtacatc
gcaccacccaattaccatatgatgatagagaccgatggttgtatcgcactgtcggtcgat
ccgcccgtcaatttttcacggccttccatcgacgtgctgttcgaaacggcggctgattat
tatagaaacgcgttgatcggtatcgtattgacaggcgctaattccgacggtgctttaggt
ctcaaaaaaatcaaaacactgggtggactaactctagtccaatccattgatagtgcagaa
gcgaaagccatgcctgctgcggccatggctgccgttgatgtcgaccacatcctttctttg
gaagagattggtcattatttaaatactttatgtgattgctga

DBGET integrated database retrieval system