KEGG   Vibrio vulnificus CMCP6: VV2_0471Help
Entry
VV2_0471          CDS       T00108                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00010  Glycolysis / Gluconeogenesis
vvu00020  Citrate cycle (TCA cycle)
vvu00620  Pyruvate metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
Module
vvu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV2_0471
   00020 Citrate cycle (TCA cycle)
    VV2_0471
   00620 Pyruvate metabolism
    VV2_0471
Enzymes [BR:vvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VV2_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_D23 DUF3008
Motif
Other DBs
NCBI-ProteinID: AAO07424
Position
II:508004..509149
Genome map
AA seq 381 aa AA seqDB search
MKTFILPDLGEGLAESEIIKWHVSVGDKVEVDQVILTVETAKATVDVPAPWAGTIITRHG
NEGDVVNIGALLLEIEDGDVTENSDQKVQQREDAATVVGHVSNQMHQVKVDDFWIGGNQN
HTTEKRVTALPSARLLAQKLGVNLEMVSGTGPSGLIMDHDVYDEAGKQRPGTEVLKGARR
TMMTTMTESHLQVAAVTITEEALLEHWSSQEDITVRLVQAVVYACQQEPALNAWFDADTV
TRCVHHTVNIGMAVDSAHGLYVPVMRHADEFSPDDIRSWINQTVSGIRERKIGREQLQHA
TITLSNFGAIAGIYATPVVSPPQVAIVGAGRIIEKVVLREGKAVAVKAMPLSITFDHRAC
TGGEAARFTKALAEHLRKPSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttatcctaccggatcttggcgaagggctcgctgagtcagaaattattaag
tggcacgtcagcgtcggtgacaaagtagaagtcgaccaagtgatcctcaccgtggaaacc
gccaaggcaacggttgatgtaccagccccatgggcaggaaccattattactcggcatggc
aatgaaggcgatgtggttaacataggtgcgctgttactggaaatcgaagacggtgatgtg
accgaaaacagcgaccaaaaagtacaacaacgcgaagatgctgccacggtggtgggtcat
gtgtccaatcagatgcatcaagtgaaagtggacgatttttggatcgggggcaaccaaaac
cacaccacagagaaacgggtgaccgccttgccatcggctcgtttgctggcgcaaaaactc
ggggtgaacttggagatggtgtctggtactggcccatccggtttgattatggatcacgat
gtctacgacgaagcgggcaaacaacgccccggtacggaagtgctcaaaggagcacgacgc
accatgatgaccacgatgaccgaatctcatctgcaagtggctgcggtcaccattactgaa
gaagcgctgttagagcattggagcagtcaagaagacattaccgttcgtttggttcaagcg
gtcgtttacgcctgccagcaagaacccgcattaaacgcatggtttgatgccgataccgtc
acacgttgcgtgcaccataccgtgaatattggtatggctgtagacagtgcccacggtttg
tatgttcctgtgatgcgacatgccgatgagttttcacctgacgacattcgtagctggata
aatcaaaccgtttcaggaattcgcgagcgcaaaattggccgtgagcagttgcaacacgct
acgatcaccctatcaaattttggtgccatcgccggaatttatgccacgcctgtggtgtca
ccgccgcaagtggcgattgtgggggcgggtcgaatcattgagaaagtggtgcttcgggaa
ggaaaagccgtggccgtcaaagcaatgcctttgtcgatcacctttgaccatcgtgcttgt
acgggtggcgaagccgcgcgctttactaaagcgttggcagagcatttaagaaaacccagt
gtataa

DBGET integrated database retrieval system