KEGG   Vibrio vulnificus CMCP6: VV2_0471Help
Entry
VV2_0471          CDS       T00108                                 

Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV2_0471
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV2_0471
   00020 Citrate cycle (TCA cycle)
    VV2_0471
   00620 Pyruvate metabolism
    VV2_0471
Enzymes [BR:vvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VV2_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:508004..509149
Genome map
AA seq 381 aa AA seqDB search
MKTFILPDLGEGLAESEIIKWHVSVGDKVEVDQVILTVETAKATVDVPAPWAGTIITRHG
NEGDVVNIGALLLEIEDGDVTENSDQKVQQREDAATVVGHVSNQMHQVKVDDFWIGGNQN
HTTEKRVTALPSARLLAQKLGVNLEMVSGTGPSGLIMDHDVYDEAGKQRPGTEVLKGARR
TMMTTMTESHLQVAAVTITEEALLEHWSSQEDITVRLVQAVVYACQQEPALNAWFDADTV
TRCVHHTVNIGMAVDSAHGLYVPVMRHADEFSPDDIRSWINQTVSGIRERKIGREQLQHA
TITLSNFGAIAGIYATPVVSPPQVAIVGAGRIIEKVVLREGKAVAVKAMPLSITFDHRAC
TGGEAARFTKALAEHLRKPSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttatcctaccggatcttggcgaagggctcgctgagtcagaaattattaag
tggcacgtcagcgtcggtgacaaagtagaagtcgaccaagtgatcctcaccgtggaaacc
gccaaggcaacggttgatgtaccagccccatgggcaggaaccattattactcggcatggc
aatgaaggcgatgtggttaacataggtgcgctgttactggaaatcgaagacggtgatgtg
accgaaaacagcgaccaaaaagtacaacaacgcgaagatgctgccacggtggtgggtcat
gtgtccaatcagatgcatcaagtgaaagtggacgatttttggatcgggggcaaccaaaac
cacaccacagagaaacgggtgaccgccttgccatcggctcgtttgctggcgcaaaaactc
ggggtgaacttggagatggtgtctggtactggcccatccggtttgattatggatcacgat
gtctacgacgaagcgggcaaacaacgccccggtacggaagtgctcaaaggagcacgacgc
accatgatgaccacgatgaccgaatctcatctgcaagtggctgcggtcaccattactgaa
gaagcgctgttagagcattggagcagtcaagaagacattaccgttcgtttggttcaagcg
gtcgtttacgcctgccagcaagaacccgcattaaacgcatggtttgatgccgataccgtc
acacgttgcgtgcaccataccgtgaatattggtatggctgtagacagtgcccacggtttg
tatgttcctgtgatgcgacatgccgatgagttttcacctgacgacattcgtagctggata
aatcaaaccgtttcaggaattcgcgagcgcaaaattggccgtgagcagttgcaacacgct
acgatcaccctatcaaattttggtgccatcgccggaatttatgccacgcctgtggtgtca
ccgccgcaagtggcgattgtgggggcgggtcgaatcattgagaaagtggtgcttcgggaa
ggaaaagccgtggccgtcaaagcaatgcctttgtcgatcacctttgaccatcgtgcttgt
acgggtggcgaagccgcgcgctttactaaagcgttggcagagcatttaagaaaacccagt
gtataa

DBGET integrated database retrieval system