KEGG   Vibrio vulnificus CMCP6: VV2_0471Help
Entry
VV2_0471          CDS       T00108                                 

Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:vvu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vvu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vvu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vvu00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:508004..509149
Genome map
AA seq 381 aa AA seqDB search
MKTFILPDLGEGLAESEIIKWHVSVGDKVEVDQVILTVETAKATVDVPAPWAGTIITRHG
NEGDVVNIGALLLEIEDGDVTENSDQKVQQREDAATVVGHVSNQMHQVKVDDFWIGGNQN
HTTEKRVTALPSARLLAQKLGVNLEMVSGTGPSGLIMDHDVYDEAGKQRPGTEVLKGARR
TMMTTMTESHLQVAAVTITEEALLEHWSSQEDITVRLVQAVVYACQQEPALNAWFDADTV
TRCVHHTVNIGMAVDSAHGLYVPVMRHADEFSPDDIRSWINQTVSGIRERKIGREQLQHA
TITLSNFGAIAGIYATPVVSPPQVAIVGAGRIIEKVVLREGKAVAVKAMPLSITFDHRAC
TGGEAARFTKALAEHLRKPSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttatcctaccggatcttggcgaagggctcgctgagtcagaaattattaag
tggcacgtcagcgtcggtgacaaagtagaagtcgaccaagtgatcctcaccgtggaaacc
gccaaggcaacggttgatgtaccagccccatgggcaggaaccattattactcggcatggc
aatgaaggcgatgtggttaacataggtgcgctgttactggaaatcgaagacggtgatgtg
accgaaaacagcgaccaaaaagtacaacaacgcgaagatgctgccacggtggtgggtcat
gtgtccaatcagatgcatcaagtgaaagtggacgatttttggatcgggggcaaccaaaac
cacaccacagagaaacgggtgaccgccttgccatcggctcgtttgctggcgcaaaaactc
ggggtgaacttggagatggtgtctggtactggcccatccggtttgattatggatcacgat
gtctacgacgaagcgggcaaacaacgccccggtacggaagtgctcaaaggagcacgacgc
accatgatgaccacgatgaccgaatctcatctgcaagtggctgcggtcaccattactgaa
gaagcgctgttagagcattggagcagtcaagaagacattaccgttcgtttggttcaagcg
gtcgtttacgcctgccagcaagaacccgcattaaacgcatggtttgatgccgataccgtc
acacgttgcgtgcaccataccgtgaatattggtatggctgtagacagtgcccacggtttg
tatgttcctgtgatgcgacatgccgatgagttttcacctgacgacattcgtagctggata
aatcaaaccgtttcaggaattcgcgagcgcaaaattggccgtgagcagttgcaacacgct
acgatcaccctatcaaattttggtgccatcgccggaatttatgccacgcctgtggtgtca
ccgccgcaagtggcgattgtgggggcgggtcgaatcattgagaaagtggtgcttcgggaa
ggaaaagccgtggccgtcaaagcaatgcctttgtcgatcacctttgaccatcgtgcttgt
acgggtggcgaagccgcgcgctttactaaagcgttggcagagcatttaagaaaacccagt
gtataa

DBGET integrated database retrieval system