KEGG   Vibrio vulnificus CMCP6: VV2_0494Help
Entry
VV2_0494          CDS       T00108                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase (isoleucine degradation)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00071  Fatty acid degradation
vvu00072  Synthesis and degradation of ketone bodies
vvu00280  Valine, leucine and isoleucine degradation
vvu00310  Lysine degradation
vvu00362  Benzoate degradation
vvu00380  Tryptophan metabolism
vvu00620  Pyruvate metabolism
vvu00630  Glyoxylate and dicarboxylate metabolism
vvu00640  Propanoate metabolism
vvu00650  Butanoate metabolism
vvu00900  Terpenoid backbone biosynthesis
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
vvu01212  Fatty acid metabolism
vvu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV2_0494
   00630 Glyoxylate and dicarboxylate metabolism
    VV2_0494
   00640 Propanoate metabolism
    VV2_0494
   00650 Butanoate metabolism
    VV2_0494
  Lipid metabolism
   00071 Fatty acid degradation
    VV2_0494
   00072 Synthesis and degradation of ketone bodies
    VV2_0494
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VV2_0494
   00310 Lysine degradation
    VV2_0494
   00380 Tryptophan metabolism
    VV2_0494
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VV2_0494
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VV2_0494
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VV2_0494
Enzymes [BR:vvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VV2_0494
Exosome [BR:vvu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VV2_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAO07445
Position
II:complement(548118..549335)
Genome map
AA seq 405 aa AA seqDB search
MAKSIWIVAAKRTPIGRFQGVLAALSAPQLGAAAIHAAMDAVSLSAQQVDEVYMGCVLPA
GCGQAPARQAALKAELGYSTPCTTVNKVCGSGMKAVMLAYDQLKAGDKCCMIAGGMESMT
NAPYLLKESRSGMRMGHKTTFDHMFLDGLQDAYEGHLMGVYAQQIADKLNYTREQMDTWA
IQSAQRATQAQHEAQFKEEITPIFLEGRSSMTLDHDEHPTTIQLDKIPKLKPAFADNGTV
TAANSSAIADGAAALILADGDWAEKQGLTPLAIIRGHASHARLPAEFTVAPVYAIEQLLS
QLDWGIDEVDLWEINEAFAVVTQIAIQQLGLAADKVNIKGGACALGHPIGASGARILVTL
IHSLRQLQALGTNGDTKCRRSVKGVAALCIGGGEATAIGIEIPVF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatcaatttggatagtggcagcaaaacgtaccccgatagggcgattccaaggg
gtgctcgccgccctgagtgcaccgcaattaggcgctgccgcgattcatgcggcgatggat
gccgtttcgttgtccgcgcaacaagtggatgaagtgtatatgggctgtgtgttgcccgca
gggtgtggtcaagcccccgcacggcaagcggcactgaaagccgaattgggttattccacg
ccttgtaccacagtcaataaagtgtgtggctctgggatgaaagcggtgatgttggcctat
gatcagctcaaagcgggtgataaatgctgcatgattgcagggggaatggagagcatgacc
aatgccccatatctattgaaagagtcgcgcagcggcatgcgaatgggccacaaaaccacc
ttcgatcatatgtttcttgatggattgcaagatgcctatgagggccatttgatgggcgtt
tatgcgcagcaaatcgctgacaaactcaattacacccgagagcaaatggacacttgggcc
attcaatcggcgcagcgtgcgactcaggcacagcacgaagcgcagttcaaagaggaaatc
accccgatttttctcgaaggacgcagcagcatgacgctggatcatgatgagcatccaacc
accattcagctcgacaaaattcccaaactgaaacccgcgtttgccgataacggtacggtg
accgccgccaattccagtgcgattgcggatggcgcagcagcactgatattggccgatggt
gattgggccgaaaaacaaggcttaacaccgctggcgatcattcgcggccacgcaagccat
gctcgcttgcccgccgagtttaccgtcgcgcccgtttatgcgattgagcaactgctcagc
cagctcgattggggaatcgacgaggtggatttgtgggagatcaacgaagcgtttgccgtc
gtgacacaaattgccatccagcagctcggcttagccgcggataaagtgaacatcaaaggg
ggggcctgtgcgttaggccaccctattggcgccagtggtgcccgaattttagtcactttg
attcacagcttgcgtcagttacaagcgttgggcaccaatggcgacactaagtgccgtcgc
agcgtcaaaggtgtggctgcactgtgcattggtggtggtgaagcgaccgctattggtatc
gaaattcccgtgttttga

DBGET integrated database retrieval system