KEGG   Vibrio vulnificus CMCP6: VV2_0568Help
Entry
VV2_0568          CDS       T00108                                 

Gene name
coxB
Definition
cytochrome c oxidase subunit II (EC:1.9.3.1)
Orthology
K02275  
cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:vvu00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(623113..624273)
Genome map
AA seq 386 aa AA seqDB search
MKKRFLTLMGLFDLMLVGFGAPAIASQTDFNMTQGVTQISQQVYELHMLIFYICCAIALI
VFGAMFYAIFKHRKSKGAVAAHFHESTKVEVIWTVIPILILVAMAIPATKTLVAMEDTSQ
SDLTVKITGSQWKWHYSYFGEDVEFFSLLATSQKQIDGLEVKGANYLLEVDNPLVVPINR
KIRFLLTSDDVIHSWWVPDFAVKKDTIPGFINEAWTRIDQPGVYRGQCAELCGRAHGFMP
VVVHAMEENDFEQWLANKKTELAEAKQAAASALTQTLSLDELMAQGEAIYSARCAVCHQA
NGMGIPGAFPAIKGSAIATGDRDKHIDIVLNGKAGTAMQAFANQLSEQEIASVVTYQRNA
FGNDTGDAVQAADVNAHKAQSRGEGQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaacgatttctcacactgatggggctgtttgacctgatgctagtcggcttcggt
gcgccagccattgcatcgcaaacagacttcaatatgacccaaggagtcacacagatcagt
cagcaggtgtatgagttgcacatgctgattttttatatctgctgtgccatagcactgatt
gtgtttggggccatgttctatgccatttttaaacaccgaaaatcgaaaggggccgtcgct
gcgcattttcatgaaagcaccaaagtggaagtgatatggacggtgattccgattttgatc
ctcgtcgcgatggcgattccagccaccaaaacgttggtggcgatggaggacacatctcaa
tctgatctgacggttaaaattaccggttctcagtggaaatggcactacagctatttcggg
gaagacgttgaatttttcagtttactggcgacctcgcaaaagcagatcgatggtcttgaa
gtcaaaggggccaattatttgttggaagtggataatcctctggttgtccccatcaatcgt
aagatccgttttcttctcacttctgatgatgtcattcattcgtggtgggtgcccgatttt
gcggtgaagaaagatactatccccggtttcatcaatgaagcatggacacgcatcgatcag
cccggggtataccgtggccagtgtgctgagttgtgtggtcgagcacatggttttatgccc
gtggtggtgcatgctatggaagagaacgattttgaacaatggcttgccaataagaaaacc
gagttagccgaagcgaagcaagcggcagcatcggcactgacgcaaacactgtcgctggat
gagttgatggctcaaggtgaagcgatttacagcgcgcgatgcgcggtttgccatcaagcc
aatggcatggggatccccggagcctttcccgccattaaaggcagtgcgattgccactggg
gatcgcgacaagcacatcgacattgttcttaatggtaaagcaggaaccgcaatgcaagct
tttgccaatcagctttctgagcaagagattgcttcggtggtcacgtatcaacgcaatgcc
tttggtaatgacacaggtgatgcggtgcaagcggctgacgtcaacgcccataaagcgcag
agtcgcggggagggacaatga

DBGET integrated database retrieval system