KEGG   Vibrio vulnificus CMCP6: VV2_0591Help
Entry
VV2_0591          CDS       T00108                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vvu00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vvu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(645483..647954)
Genome map
AA seq 823 aa AA seqDB search
MNKATLALLISGVLMAPITMAMAPNTDLVLMPYPQNVELSEGKVTLDKAFSIYIKGYDSP
RVAFNVKRTMERLYRQTGLPMLNWQAKSEQEATLVIDIQRAPSSAVQNIDSDESYQLKVA
NGKILLSSTEPYGAFHGLETLLQLVSTDANGYFVPAVAISDAPRFKWRGVSYDTARHYIE
LPVILRQLDAMASAKMNVFHWHIWDDQGIRIQLENYPRLWQATADGDFYSKDEIRQVVEY
ARNLGIRVIPEISLPGHASAVAHAYPELMSGLGEQSYPQQRGWGVFEPLMDPTNPELYTM
LASVFDEVVELFPDEYFHIGGDEPNYQQWRDNPKIQAFIKQHQLDGERGLQSYLNSRVEQ
MLNQRGKKITGWDEIWHKDLPKSVVIQSWQGHDSIGRAAKEGYQGILSTGYYLDQPQPTS
YHYRNDPMPKGITVDDQLHQGEKFVTYDWVKPRNKGGPRKGNLTIIEGADGKVRAFTDYN
GKSREEVYVLEYVPGVLFRGHFDNFMSYTEFNYQFAGDQLKEGSYQRIGNVRWPATGNLV
ASSEREVTSIPQPNGGYPAQLTKQEEPLILGGEVTIWGENLDSMTIEQRLWPRSYAIAER
LWSSESLTDEASMYRRMRALDSWSEISLGLRHHADARMMLQRLANGADVAPLITLAKYTE
PAQYYARHWEKWISTPNKGDLYNQYERLNRFADALVVESYAVYDMEAWVRGYQPNGNAQS
PQSKQALEELSEHYQAVKGAARQSRGIFAANVASRESVAIAEATIALAELGLELVEKAQQ
GQVLSAAERATYQAILDKNAVIFDETIVAIVRPTEQLLHKIAP
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctacactggctctactgatttcaggcgtactgatggcaccgataacgatg
gcaatggctcccaataccgatttggttttaatgccttacccgcaaaacgttgagttaagc
gaaggcaaggtgacgctggataaagcgttcagtatttatatcaaaggttacgactcaccg
cgcgtggcgtttaacgttaagcgcaccatggagcggctctatcgacaaactggcttgccg
atgctgaattggcaggcaaaatccgaacaagaagcaacgttggtgatagatattcaacgt
gccccaagcagtgcggtgcaaaatatcgacagcgatgagtcataccaattgaaggttgca
aatggcaagattttgctttcatccactgagccttatggcgcgtttcatggcttagaaacc
ttactgcaactggtttcgacggatgccaatggctacttcgttcccgccgttgctatctct
gatgcgccgcgttttaaatggcgtggggtgtcgtacgatactgcgcgtcattacatcgaa
ctgccggtgattttgcgccaattggatgccatggcctcagcgaaaatgaacgtcttccac
tggcatatctgggatgaccaaggcattcgtattcaactggaaaactaccctcgcttatgg
caagccaccgcggatggtgatttctacagcaaagatgaaattcgccaagtggttgagtac
gcgcgtaatcttggtattcgtgtgatccctgaaatctcgctgcctggccatgcttcggcg
gtcgcgcacgcctatccggaattgatgtctggccttggtgaacagtcttaccctcagcag
cgtggttggggtgtgtttgaacctttgatggacccaaccaatccagaactctacaccatg
ttggcaagcgtattcgatgaagtggtcgagctcttcccagatgagtattttcacatcggc
ggggatgagccgaactatcaacagtggcgtgacaacccgaaaatccaagcgtttatcaaa
cagcatcaattggacggcgaacgagggctgcaatcgtacctgaatagccgagtcgagcag
atgctgaaccagcgcggcaagaaaatcacaggctgggatgaaatttggcataaagatctg
ccgaaatcggtggtgattcagagttggcaggggcatgacagtattggccgagcggccaaa
gagggctatcaaggcattttgtcgacgggttattatctcgatcagcctcaacccaccagc
taccattatcgtaatgacccgatgccgaaggggatcaccgtcgatgatcaactgcatcaa
ggggaaaaatttgtcacctacgattgggtgaagcctcgcaataaaggaggcccgcgcaaa
gggaatctcaccatcatcgagggtgctgacggcaaagtgcgtgcatttaccgattacaat
ggtaaatcgcgtgaagaagtgtatgtattggaatacgtccccggagtgctattccgtggc
cattttgacaacttcatgtcctacactgaattcaattatcagtttgctggtgatcaacta
aaagaaggcagctatcagcgtattggcaatgtgcgttggccagcaactggcaatttggtg
gcctctagcgagagagaagtgacgagcattccgcaacccaatggcggttatcctgctcaa
ctgaccaaacaagaggagccattgatcctcggtggtgaagtgaccatttggggtgaaaat
ctcgattcgatgaccatagaacagcgcttatggccacgcagctatgcgattgccgaacga
ctttggtcaagtgaatcgctcactgatgaagccagtatgtaccgtcgaatgcgcgcgctg
gatagttggtcggaaatttctcttggcctgcgtcatcatgcggatgctcggatgatgctt
cagcgtttagccaatggggcagatgttgcgccgctcatcacgttagccaaatacacggag
cctgcacaatattatgcgaggcactgggagaaatggatttctacgccaaacaaaggggat
ttgtacaaccaatatgaacgcttaaatcggttcgccgatgccctcgtggtagaaagctat
gcggtgtatgacatggaagcgtgggtgcgtggctatcagccaaatggcaatgcgcaaagt
ccgcaaagcaagcaggcgcttgaggagctttctgagcattatcaggcggtgaaaggtgcg
gcgcgccaatctcgtgggatttttgctgccaatgtggcctcacgtgagagtgtggcgatc
gcagaggcaaccatagcgttagcagagctgggtcttgagttggtggaaaaagcgcaacag
ggacaagtgctttcagctgctgagcgagcgacttatcaagcgatattggataagaatgcg
gtcatttttgatgaaaccattgtggcgatagtaagaccaaccgagcagctacttcacaaa
attgcaccttag

DBGET integrated database retrieval system