KEGG   Vibrio vulnificus CMCP6: VV2_0949Help
Entry
VV2_0949          CDS       T00108                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vvu  Vibrio vulnificus CMCP6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1022905..1023891)
Genome map
AA seq 328 aa AA seqDB search
MKKIIAVSLLSVVSFATLAERQAQEPIKVIDPIVGLDAKKVELGKTLWFEPRLSASNTIS
CNSCHNVAKGGVDNLPSSIGHKWAIGPINSPTVFNSDLNFVQFWNGRAKDLQEQAAGPIE
NPLEMAFTHQLAIDTLKSIPQYRTWFKQAYGVEEFTLEQVTDAIATFEKTLRTPNAPFDL
WLRGEDRALTTAQVEGYELFKAKGCTACHSGPLAGGQMYQKMGLVKPFETANPDVGRKAI
TGKEFDEFVFKVPTLRNIELTYPYFHDGSVWDLQEAVEVMADIQLGQKLTKDESGKITEF
LKSLTGEQPQIVLPHLPPSTIETARPQI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcattgcagtgagtctcttatctgtcgtgtcatttgcgaccttggcagaa
cgtcaggcgcaagaaccgatcaaagtgattgatccgattgttgggttggatgcgaagaaa
gttgaattgggaaaaaccttatggtttgagcctcgactatcagcctctaacaccatttcg
tgtaactcatgccataacgtggccaagggtggggtggataacctgccaagctccattgga
cataaatgggcgattgggccgatcaattcacccacggtgtttaactcggatctcaacttc
gtgcagttctggaatggtcgcgccaaagatcttcaagagcaggccgcagggccgattgag
aatccgctagagatggcattcacccatcagttggcgatcgataccttgaaatcgattcct
caataccgcacttggttcaaacaagcgtatggggtggaagagttcaccttagagcaagtt
acggacgccatcgcgacctttgagaaaacgcttcgtacccccaatgcaccgtttgacttg
tggttaagaggggaagaccgcgcgctcaccacggcccaagtggaaggttatgagctgttc
aaagcgaaggggtgtacggcgtgtcatagcgggcccttagccggagggcagatgtaccaa
aaaatggggttagtaaagccttttgaaaccgccaatccagatgtagggcgcaaggcgatt
actggcaaagagttcgatgagtttgtctttaaggtgccgacattacgcaatattgagctc
acctacccctacttccacgacggctcagtgtgggatcttcaagaagcggtagaagtgatg
gcagacattcagttggggcaaaaactgaccaaagatgagtctggtaaaatcaccgagttt
ctcaaatctctgacgggtgaacagccgcaaatcgttttgccgcatttaccaccgtctacg
attgaaacggcgcgaccacaaatctaa

DBGET integrated database retrieval system