KEGG   Vibrio vulnificus CMCP6: VV2_1161Help
Entry
VV2_1161          CDS       T00108                                 

Definition
Chemotaxis response regulator protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vvu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vvu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1258127..1259161)
Genome map
AA seq 344 aa AA seqDB search
MSKKIKVLVVDDSPVFRALLSEIINSDPQLEVIGAAEDPYQAREMIKALKPDVLTLDIEM
PKMNGVQFLKNLMRLHPLPVVMISTLTQHGADATLMALELGAVDYFPKPSVANTADMLGY
RSLVNEKIRMAAQAQVGANQSMSPAVASSSAVSTSQYQLIAIGASTGGTEAVKHLLSALP
ASMPPIVITQHISAMFSGPFASRLDASCALSVSELTQGEVALKTNHAYVAPGDKHLMVFR
RGGQLYAHLDDSPAVNRHKPSVDVMFGSVAESLKGKAIGVILTGMGKDGAQGMLQMKQQG
AITVAQDEQSCVVYGMPRAAVECGAAMHIKPLNKLPQFLCDLLS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaagattaaagtcttggtggtggatgattcccccgttttcagagccttgctc
tcggagatcattaattcggatcctcaattagaggtgatcggcgcggctgaagatccttat
caagcgcgtgagatgatcaaagctttaaagccagatgtgctgactctcgacatcgaaatg
cccaagatgaatggcgttcagtttctcaaaaacctaatgcgcctgcatcctttgcccgtg
gtgatgatctcaacgctcacccagcatggcgcagacgcgacactgatggctttagagctt
ggcgcggtggattattttcccaaaccatcggtggccaataccgccgatatgctgggttat
cgcagcttagtgaacgaaaaaatccgcatggccgctcaggcgcaagtgggggcgaatcaa
agcatgtcgccagcagtggccagcagcagtgcggtttccactagccaatatcagctcatt
gccattggcgcgtccaccggaggtaccgaggcagtgaaacatctgctctcagccttgcca
gccagcatgccaccgattgtgattacccaacacatcagcgcgatgttttctggcccgttt
gccagccgattggacgccagttgtgcgttgagtgtcagtgaactcactcaaggggaagtc
gctttaaaaaccaatcatgcctacgttgcgccgggggacaaacacttaatggtgtttcgt
cgcggagggcagttgtatgcccatttggatgacagcccggcggtgaatcgacacaagcct
tcggtggatgtgatgtttggctcagtcgcggaaagtttaaaaggcaaagcgataggcgtg
atcctcactggaatggggaaagatggcgcgcaaggcatgctgcaaatgaagcagcaaggg
gccatcaccgtggcgcaagatgagcagagttgcgtggtgtatggcatgccgcgggctgcg
gtggagtgtggcgccgccatgcacatcaaaccactcaataaacttcctcagtttttgtgc
gatctactaagctaa

DBGET integrated database retrieval system