KEGG   Vibrio vulnificus CMCP6: VV2_1251Help
Entry
VV2_1251          CDS       T00108                                 

Gene name
malQ
Definition
(RefSeq) 4-alpha-glucanotransferase (EC:2.4.1.25)
  KO
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VV2_1251 (malQ)
Enzymes [BR:vvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VV2_1251 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
II:1366806..1368986
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVAEMARLADSYVSAWGDEALVSEETLRRLLNSLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGDPVEVELNLGTSARESEFNWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKDLAWGYHKLYVSRKRRKAPYEMALIITPRACFKQDSLELNKKLWGPSIQLY
TLRTQHNWGIGDFGDLKLLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
LYIDVSSVPEFALSAEAQQKVGSAEFQQRLQKARESHWVNYTEVAELKMSVLPLLFAEFK
TRHLDKNSDRARAFLEFVEEGGDSLVHQAAFDALHAELHAQDSNVWGWPVFPEQYRRFDS
AATQKFIKDNQEKVHLYMYLQWIADGQIKEAQALAEEKGMSVGLYRDLAVGVADSGSETW
ADNGNLVLDASIGAPPDILGPLGQNWGLPPLNPEVLQATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYADQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPNEEQLNGLFDDRLKCKQGILDSVRWHGYLPEGIGHDAQYVPMDAHLSEALQLHVA
AGASALLSVQLEDWLQMDNPVNIPGTVDEYPNWRRKLSMNLEEIFSREDVNRIARRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcattaaagaaagtcgcagaaatggcacgattagctgacagctat
gtcagcgcttggggagacgaagcattggtctccgaagaaacgctacgccgcctgctcaac
tctcttggctatgacactagcagcgatgaaaaactactggcttcagctgagaaaaaacac
aagaaagacgtattagcgccagtattggtattgcgtgatggcgatccggtggaagtggaa
ctgaatcttggcaccagtgcgcgtgaaagcgagttcaactggcgtttagaaacagaacaa
ggagaggtactggaaggctatcttcagtcacagattgttcgcgatgaacgtgccgagggt
ggccctctagtgtttgccctgccaaaagatttggcttggggttatcacaaactatacgtg
agccgtaagcgtcgtaaagcaccgtatgaaatggcgttgatcatcacgccacgcgcttgt
ttcaaacaagattctctagagttgaacaaaaagctctggggcccaagtattcagctttac
accctacgcacccagcacaactggggtatcggtgattttggcgatcttaaattgctggtg
agtgacatcgcatctcgcggcggtgatttcatcggtctgaacccgatccactcgctattt
cctgccaaccctgaaggcgctagcccatacagcccatcgtctcgccgttggttgaacatt
ctttatatcgatgtgagctctgttcctgagtttgcgctcagtgcggaagcacaacagaaa
gttggcagcgccgaattccagcagcgcctgcaaaaagcgcgcgaatcacattgggtgaac
tacaccgaagtggcagagctgaaaatgagcgtattgccactgctgtttgcggagtttaaa
actcgccatctcgacaaaaacagcgatcgtgctcgcgcgttcctagagtttgtggaagaa
ggcggtgacagcctcgtgcaccaagcggcgttcgatgcattgcacgcagagctacacgcg
caagattcaaacgtgtggggctggccagttttccctgagcaataccgccgctttgattct
gccgcgacgcagaaattcatcaaagacaaccaagaaaaagtgcacctttatatgtacttg
cagtggattgccgacggccagatcaaagaagcgcaagcgctggctgaagagaaaggcatg
tccgttggtctctaccgtgaccttgcagtcggtgtggctgattctggtagcgaaacatgg
gcagataacggcaacctagtactggatgccagcatcggtgcgccaccggatatccttggt
ccactgggccaaaactggggtctgccaccactcaaccctgaagtgctgcaagccactggt
tatgacgcgtacatcaaactgctgcgtgccaacatgaaacattgtggcgcactgcgtatt
gaccacgtacttggccttcttcgcctatggtggattccaaaaggcgaaaaagcgacagaa
ggggcgtacctctactacccagtcgaagacatgctagcgattttggcgttggaatctcac
cgtcatcagtgcagcgtgatcggtgaagacttgggcacggtgccagatgaaatcgttgat
atcctgcgtgatgcgggtgtgcactcatacaaagtgttcttcttcgagacatcaaaagaa
gatggtggtttcatttcgccaaaacactatgccgatcagtcgatggcggccttgtgtacc
catgatatgccaacgctacgcggcttctggcattgcgatgacctcaaaatgggtcgcgaa
attggcctctatccaaacgaagagcagctcaatggcttgttcgacgatcgcctaaaatgc
aagcaaggcattctggacagcgtgcgttggcatggttacttgccagaaggcattggccac
gatgcgcaatacgtgccaatggatgcgcatttaagtgaagcattgcagttgcatgttgca
gcaggcgcttccgcactgctcagtgttcagctggaagactggttgcaaatggacaaccca
gtcaacatcccgggcacggtcgatgagtacccgaactggcgtcgtaaattgtcgatgaac
cttgaagagattttcagccgtgaggatgtgaatcgaatcgctcgtcgtctaacggaagtg
cgcgcgcaagcgagcaaataa

DBGET integrated database retrieval system