KEGG   Vibrio vulnificus CMCP6: VV2_1327Help
Entry
VV2_1327          CDS       T00108                                 

Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VV2_1327
  Lipid metabolism
   00600 Sphingolipid metabolism
    VV2_1327
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VV2_1327
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VV2_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1459584..1462682)
Genome map
AA seq 1032 aa AA seqDB search
MTAFSEILQRRDWENPQSVNIHCLKAHSPLASFRDMAHARDGIHAQRQSLNGQWKFKLFD
APEQVDGQFTQADFNDAEWDEIPVPSNWQLQGYDKPIYANIKYPFDVNPPFVPSDNPTGC
YRTRVSLSPEDLLNTQRIIFDGVNSAFHLWCNGTWVGYSQDSRLPAEFDLTSHLVAGENT
LAVMVMRWCDGSYLEDQDMWWLSGIFRDVTLLSKPQHCIEDVFITPELDACYRDGSLSIV
TTIAAPETYQVQVQLFEGTQAVTEPNIARPHNRRIDERGTWNDDVVFQTLHLREPKKWTA
ETPNLYRLVVSLLDENGTHLESEAYPVGFRKVEISEGQLKLNGKPLLIRGVNRHEHHPEL
GHVMTEEDMIRDICLMKQYNFNAVRTAHYPNHPRWYELCDQYGLYVCDEANIETHGMQPM
SRLSSDPQWAHAYMSRYTQMVLRDKNHPSIIIWSLGNESGHGSNHNAMYAWSKNFDPSRP
VQYEGGGSNTTATDIIAPMYARVNTLVADEAVPKWPIKKWISLPNETRPLILCEYAHAMG
NSLGSFDEYWAAFREFPRLQGGFIWDWVDQGLSQWDENGQHFWAYGGDFGDEINDRQFCI
NGLIFPDRTVHPTLQEAKYCQRMITVSLQEQTQKACTLLVTNENLFRTTDNEQLNWSLLE
NGQVIQTGSQVLSVEADSQTRLEIALNFTPKAQAQYYLNTDICLIEATSWAPAGHVVATE
QMALRNHAGLAMPTLRTQPAPKLTENGHAIVVSSLDEKHQWRWDSQSGLLMEWNVDGKAQ
MLAAPQDNFFRAPLDNDIGISEVDNVDPNAWVCRWEMAGIGQWERHCVQCESETLAHAVV
VTTTFAYHFGGDVQAITQWTHTLSNDGEMLLDVDVTLADALPPMPRIGLELQLPLHQADT
PITWQGLGPFENYPDRLAAARFGLHTQTLAQMHTPYIFPTDSGLRCGTQWLQVNELAISG
DFQFSVSQYAQQQLAEAKHTHDLLAQERIYLRLDHQHMGVGGDDSWSPSVHKEFQLTEKH
YRYQLRFSPASR
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgactgcattttcagaaattctccaacgacgcgactgggaaaacccgcaatccgtaaac
attcactgcctaaaggcacatagcccactcgccagttttcgcgatatggcccatgctcgc
gatggtattcacgcccagcgtcaatcgctaaatggacaatggaaattcaaactgtttgat
gcgccagagcaggtggatggccagttcacgcaggccgatttcaatgacgcggaatgggat
gagatccccgtgccgtctaactggcaactgcaaggttacgacaaacccatttacgccaat
attaaatacccatttgacgtaaacccgccgtttgtaccaagtgataacccaaccggttgc
taccgcactagggtatcgttgtcgccagaagatttgctcaacacccaacgcatcatcttc
gacggtgtgaattcggcgttccatctttggtgtaacggcacttgggttggctacagtcaa
gacagccgtttgcctgccgagtttgatctcacatcgcatctcgtggcgggggaaaatacg
ctcgcggtcatggtgatgcgttggtgtgatggcagctatctagaagaccaagacatgtgg
tggctaagcggtatcttccgtgacgtgacattgctgtcgaaaccacaacactgcattgaa
gatgtgttcatcacgccggagctcgacgcctgctatcgcgacggctcgctctccatcgtc
accaccattgcagcgccagaaacctatcaagtacaggttcaattgtttgagggtacacaa
gcggtcactgagccaaacatcgctcgcccacacaaccgtcgcatcgacgagcggggcact
tggaatgatgatgtggtattccaaaccctacacctacgcgagccaaagaaatggacggcg
gaaacaccgaacctctaccgcttagttgtttcactgttggatgaaaatggcacgcatctc
gagagcgaagcgtaccctgtgggctttcgtaaagtggaaatcagcgagggtcaattgaag
ctcaacggcaagccgctgctgatccgcggggtcaatcgccacgagcatcatcctgagctg
ggccatgtgatgacagaagaggatatgatccgcgacatctgcctgatgaaacaatacaac
ttcaacgcagtgcgcaccgctcactatccgaaccatccgcgttggtacgaactgtgtgac
caatacggcttgtacgtgtgtgatgaagcaaacattgaaacccacggcatgcagccaatg
agccgcttatcgagcgatccgcaatgggcgcacgcgtacatgagtcgctacacccaaatg
gtcctgcgcgataagaaccatccatcaatcatcatctggtctttaggtaatgaatcgggc
cacggcagcaaccacaatgcgatgtacgcttggtcgaaaaactttgatccgtcacgccct
gtgcaatacgaaggcggcggttcaaacaccacggcaaccgacattattgcgccgatgtac
gctcgcgtgaatacccttgttgccgatgaagcggtgccaaaatggccaatcaaaaaatgg
atttctctccccaacgaaacgcgcccattgatcttgtgcgaatacgcccatgccatgggc
aatagcctaggcagttttgatgaatactgggcggcctttcgcgagttcccacgcctacaa
ggcggctttatttgggattgggtcgaccaaggcttgagccaatgggatgaaaacggccag
cacttctgggcttacggcggcgattttggcgatgaaatcaatgaccgccagttctgcatc
aacggtttgatcttccccgatcgcaccgtgcatccaacgttgcaagaagcaaaatactgc
cagcgcatgatcaccgtctcgctgcaagagcaaacccaaaaagcgtgcacactgttggtg
accaacgagaacctgttccgtaccactgataacgagcaattgaactggtcactgttggaa
aatggccaagtcatccaaacgggttcacaggtgcttagcgtagaggctgacagccaaaca
cgccttgaaattgcgctgaatttcacgccaaaagcgcaggcgcaatactacttaaatacc
gacatctgccttattgaagcgacgtcatgggctcccgctggccatgtggtggcgacagag
caaatggcgctgcgcaatcacgctggccttgccatgccaactttgcgcacacagcctgca
cccaagctgaccgaaaacggccacgccattgtggtcagcagtctggatgaaaagcatcaa
tggcgctgggatagccaaagcggtttgctgatggaatggaacgtggatggcaaagcgcaa
atgctggccgcgccgcaagacaacttcttccgcgccccgctggataacgacatcggcatc
agtgaagtggataacgttgatcccaatgcttgggtgtgccgctgggagatggcgggcatt
ggtcagtgggagcgtcattgcgtccagtgcgagagcgaaacgctcgctcacgccgtggtc
gtgaccaccacgtttgcctaccactttggcggcgacgtgcaagccattacccagtggacg
cacacactcagcaacgatggcgagatgctattggatgtcgacgtcacattggcagatgct
ctgccgccgatgccgcgtattggcttggagttgcaactgccgcttcaccaagccgacacg
ccgatcacatggcaaggcttaggcccatttgaaaactacccagatcgcttagccgcagca
cgttttggcttacatactcaaacactggcgcagatgcacacaccgtacatcttcccaacc
gacagcggcctgcgttgtggcacgcagtggctgcaagtgaacgagttggccatctcgggt
gatttccagttcagtgttagccaatacgctcagcaacaattggcagaagcgaaacatacc
catgatttgctagcgcaagagcggatttacctgcgtctagaccaccagcacatgggggtt
ggcggtgacgattcttggagcccaagtgtgcacaaagaattccaattaacggagaaacac
taccgctaccagttgcgatttagcccggcttcacgctag

DBGET integrated database retrieval system