KEGG   Vibrio vulnificus CMCP6: VV2_1647Help
Entry
VV2_1647          CDS       T00108                                 

Definition
(GenBank) Malate synthase-related protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00620  Pyruvate metabolism
vvu00630  Glyoxylate and dicarboxylate metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01200  Carbon metabolism
Module
vvu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV2_1647
   00630 Glyoxylate and dicarboxylate metabolism
    VV2_1647
Enzymes [BR:vvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VV2_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAO08505
Position
II:1800617..1801237
Genome map
AA seq 206 aa AA seqDB search
MCSKTKLLCVIQEDKTMNMLTFDKNENQQQRPFIAEAVFAVEAVNSNQQDEKQQKAKQLL
DRMFPLESGSHQDVTSYVIDYRHLMAYFADGSHSGLQAPKHFVAFTGEKEDPCSILLRDE
SGSHIEVMLGCHKGTGSVELVDIDDIQLETRTTFSPELTGDAPTAMRHWISLVKGDVNGK
PMASSEDKEYTAKSGEDYVLSYCYSI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctaaaacaaaattgttgtgtgttatccaagaggacaagacgatgaatatgctg
acattcgataaaaatgaaaaccaacaacaacgcccatttatcgctgaagctgtatttgcc
gtcgaagcggtaaattctaatcagcaagatgaaaaacaacaaaaagcgaaacagcttctc
gacagaatgtttccgctagaatctggctcacatcaagacgtaaccagctatgtgatcgat
tatcgccacctgatggcatattttgcagatggttcccacagtggccttcaagcacccaaa
cattttgtcgctttcaccggtgagaaagaagatccttgctctatcttgctacgcgatgaa
tcaggcagtcacattgaagtgatgctgggttgccacaaaggtacaggaagtgtggaactt
gtcgatatcgatgatattcaattggaaacgcgcacgacctttagccctgaattaacgggt
gatgcaccaacggcaatgcgtcattggatcagtctagtgaaaggcgatgtgaatggtaag
ccaatggcaagcagtgaagataaagaatataccgcgaaaagtggtgaagattatgtactg
agttactgctatagcatctaa

DBGET integrated database retrieval system