KEGG   Vibrio vulnificus CMCP6: VV2_1648Help
Entry
VV2_1648          CDS       T00108                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
vvu  Vibrio vulnificus CMCP6
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1801397..1802413)
Genome map
AA seq 338 aa AA seqDB search
MTSDDFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDNTIPQLNQEMDTVLENYGIC
PPATNEQLYNNYVASKAETSMKDLRSNIEVLLLEVASSMTDTIADTSSFSTLVDKNFSKL
EKVEDEGLSIEEVMGVIRELVTESREIRHSTRFLTSQLNNASNEISRLKEQLAEVQRDAL
FDGLSTLYNRRAFDSDLKALVNAQQNLSLILLDIDHFKTFNDNYGHLFGDSVIRAIAKRL
QTSCREGIAAYRFGGEEFALIVPNKSLRIARQYAESLRRTIEKLKVKDKRSGQQVENISA
SFGVAELKPDETAESLIERADKLLYEAKQLGRNRVMPL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgacgactttaagaaatccaccgctaatttgaaaaaagcggtacctttgatg
attaagaatcacgtagctgccacacccgcaaactatgccctttggtatacctacgtggac
aacaccattcctcaactcaaccaggaaatggataccgttttagaaaactacggtatctgc
ccacccgcgactaacgagcagctctacaacaactacgtagcaagcaaagcggaaaccagc
atgaaggacctgagaagcaacattgaagtgttgttgctcgaggttgcgagctccatgacg
gataccatcgcggacacttcctctttttcgaccctcgttgataaaaatttcagcaagtta
gagaaagtcgaagatgaaggcttgagcattgaagaagtgatgggcgttatacgtgaactg
gtgacagagtcacgcgagatccgccactccacccgtttcctcactagccaactcaataac
gcgagcaacgaaatctctcgcttgaaagagcagttagcggaagtgcaaagagacgctctc
tttgatggattatccacgctttacaatcgccgcgcgttcgatagtgatctcaaggcactc
gtgaatgcccagcaaaacctaagccttatcttgctcgacatcgatcattttaaaaccttc
aacgacaactatggccacctgtttggcgattcggtgattcgcgcgattgccaaacgactg
caaacaagttgccgtgaaggcattgcagcgtatcgatttggtggagaagagtttgcgttg
attgtgcctaataaatctctgcgcattgctcgtcaatacgctgagtcactgcgccgcact
atcgaaaaactgaaagtcaaagataaacgctctggccagcaagtggaaaacatcagtgct
tcatttggtgttgccgagttgaagccagacgaaaccgcagaatcgttgatcgaacgtgca
gacaaactgctttatgaagcgaagcaacttggtcgtaaccgcgtaatgccactgtaa

DBGET integrated database retrieval system