KEGG   Vibrio vulnificus YJ016: VV0029Help
Entry
VV0029            CDS       T00150                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV0029 (fadB)
   01212 Fatty acid metabolism
    VV0029 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VV0029 (fadB)
   00650 Butanoate metabolism
    VV0029 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VV0029 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VV0029 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VV0029 (fadB)
   00310 Lysine degradation
    VV0029 (fadB)
   00380 Tryptophan metabolism
    VV0029 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VV0029 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VV0029 (fadB)
   00281 Geraniol degradation
    VV0029 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VV0029 (fadB)
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VV0029 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VV0029 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VV0029 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     VV0029 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(27203..29374)
Genome map
AA seq 723 aa AA seqDB search
MIYQAETLQVKEVQDGVAEILFCAQNSVNKLDLATLASLDKALDALTAHSGLKGVMLTSD
KEAFIVGADITEFLGLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCEC
VLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRAEEALK
IGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSALTLSKLEAMMSFTMAKGLV
AQVAGPHYPAPMTAVVTIEEGARFARNQALDIERKHFVKLAKSEEAKALVGLFLNDQYIK
GIAKKAAKSANKETQRAAVLGAGIMGGGIAYQSALKGVPVIMKDIAQASLDLGMTEASKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVEAVVENPKVKAAVLSEVEEQVS
EETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFEANKYGQKNGSGFYTYTMDKKGK
PKKAFSDEIVPILAPVCAAQQAFDDQTIIQRMMIPMINEVVLCLQEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVELGAMYQVPQMLIDMAERGQTFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgaaaccctacaggtaaaggaagtacaagatggagtggcagaaatc
cttttctgcgcacaaaattccgtcaataagctcgatctagcaacccttgcttcactcgac
aaagcgcttgatgcgctcaccgctcactccggtctgaaaggcgtaatgcttacatcagac
aaagaagcctttattgtcggagcagatatcactgagtttttaggactgtttgccaagcca
gaagaagagcttgaccaatggcttcaatttgccaatagcatcttcaataaactggaagat
ttgcccgttccgactgtcgcggttgtcaaagggcataccttaggcggtggatgtgagtgt
gtacttgctaccgacttacgcattggtgataaaaccaccagcattggtcttcctgaaacc
aaactcggcattatgcctggctttggcggttgtgtgcgtttgccgcgcgtgatcggcgca
gacagcgccatggaaatcatcacccaaggcaaagcttgccgtgcagaggaagctctaaaa
attggtttgcttgatgctgtcgtcgattccgatcgcctctacgcatccgccctgcaaaca
ctcaccgatgccatcaatgaaaaaattgactggaaagcacgtcgccagcaaaaaacctca
gcgttaacgctaagcaaactcgaagcgatgatgagtttcaccatggccaaaggcttggta
gctcaagtggcagggccacactaccctgcaccgatgaccgccgttgtcacgattgaagaa
ggtgcccgttttgcgcgcaatcaagcgctagacatcgaaagaaaacatttcgttaaactg
gcgaagtcagaagaagccaaggccttggtgggtcttttcctcaatgaccaatacatcaaa
ggcatagcgaagaaagcagcaaaatccgccaataaagagacccaacgtgcagcagtgctg
ggcgcaggtattatggggggcggcatagcctaccaatctgctctcaaaggtgtgcccgtg
atcatgaaagacatcgcgcaagcatcactggatctgggcatgacggaagcgtcaaagcta
ctcaacaaacagcttgaacgtggcaagattgatggctttaaaatggccggcattctcgct
tctattacgccaagccttcactacgcgggcatcgataacgccgatatcatcgtagaagcc
gtggtcgaaaacccgaaagtgaaagcagccgtattaagcgaagtggaagagcaagtgagc
gaagagaccgttctcacttcgaacacctcgaccattccaattaacttgctggccaaatca
ctcaaacgaccagagaatttctgtggtatgcacttcttcaaccctgtgcatcgcatgcct
ttggtcgaaatcattcgtggcgaacacacctccgatgaaaccatcaaccgtgtcgttgct
tacgcagccaaaatgggcaaatccccaattgtggtcaatgactgcccagggttctttgtt
aaccgcgtgctgttcccatactttggtggttttagcatgttgctgcgcgatggtgccgac
ttcactcaaatcgataaagtgatggaacgtaagttcggttggccaatgggccctgcttac
ttattggatgtggtcggtattgataccgcacaccacgctcaagccgtcatggcgcaaggg
ttccctgagcgcatgggtaaacaaggtcgcgatgcgattgatgcattatttgaagctaac
aagtatggccagaaaaacggcagcggtttctacacgtacaccatggacaagaaaggcaaa
ccgaagaaagcattcagtgatgagatcgtaccgattcttgctccagtttgtgctgctcaa
caagcctttgacgatcagaccattatccaacgcatgatgattccgatgatcaacgaagtg
gtgctttgcttgcaagaaggcattatcgcctcagcgcaagaagcggatatggcgctggtg
tatggccttggtttccctcctttccgtggtggtgtattccgctacttagatagtgttggt
attgcaaactttgtcgcaatggcacagcagcatgtcgaacttggcgctatgtatcaggtt
ccacaaatgcttattgatatggctgaaagagggcaaaccttttacggcgcgcaacagcaa
ggttctatctaa

DBGET integrated database retrieval system