KEGG   Vibrio vulnificus YJ016: VV0096Help
Entry
VV0096            CDS       T00150                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VV0096
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VV0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(108085..109083)
Genome map
AA seq 332 aa AA seqDB search
MVNNSSPLSYTQEALFEQAIGGPIAALWQQRQEGFLKTRDKMQLYWCKLTNPQHKKAVLV
VNGRIESAWKYQELLFDLYRQGYDVYSYDHRGQGLSDRLVKDSDIGHVYEFDDYILDMEA
VIAHFDFSPYQQRHIVSHSMGGAVATRYLQTHPQHGFDKLVLSAPMFGIDLPWYLSPVAM
AVSQILTAVYPTPTYAPGHKSYYEKPFEDNPLSQSQARYQWFRQLYRDKPELQVGGPSTR
WVWQGLMAAKQCILLTRQLTIPVLLLQAGGDRIVSNQAQSQFFKKLHKTNKRSEMVTIEG
AQHELLFEKDHYRNQALSAMFRFLQKEESNQA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggttaataacagctcacctctctcttatacgcaagaggctttatttgagcaagcaata
ggtggtccgatcgctgccctatggcagcagcgacaagagggtttcctaaaaacgcgcgat
aagatgcagttgtattggtgtaagctgaccaacccgcaacacaaaaaggcggtgctggta
gtgaatggcagaatcgaatctgcttggaagtaccaagaacttctgtttgatctctaccgt
caaggctatgacgtctacagctacgatcatcgaggccaaggtttatcagatcgcctggtg
aaagactctgatattggtcacgtctacgagtttgatgattacattctcgacatggaagcc
gtgattgcgcattttgatttctctccttatcagcagcgacacattgtttctcattcgatg
ggcggtgccgtcgccacgcgctacttacaaacccacccacaacatggttttgataagttg
gtgctcagtgcgccgatgtttggtatcgatctcccttggtatttgagtccagtggccatg
gcggtcagccaaattctcaccgccgtgtacccaacgcctacttatgcgccgggacacaaa
agttattatgagaagccctttgaagataacccgctcagccagagccaagcgcgttatcaa
tggtttagacagttgtatcgtgacaagcccgagctgcaagtgggtggcccgagcacccgt
tgggtgtggcaaggcttaatggccgccaaacagtgcattttgctgacgcgccaactcacc
attccggtgttgctgttgcaggcagggggcgatcgcatcgtcagcaatcaagcacagtcg
cagtttttcaaaaagctgcacaaaaccaataagcgcagcgaaatggtgacgattgaaggt
gcgcaacatgaattgttgtttgagaaagaccactaccgtaatcaagcactcagcgcgatg
ttccgctttttgcagaaagaggaaagcaaccaagcttaa

DBGET integrated database retrieval system